PDB entry 2cay

View 2cay on RCSB PDB site
Description: Vps36 N-terminal PH domain
Class: transport
Keywords: transport, vps36, ph domain, escrt-II, lipid-binding, multivesicular bodies, membrane, metal-binding, protein transport, zinc, zinc-finger
Deposited on 2005-12-23, released 2006-04-07
The last revision prior to the SCOPe 2.08 freeze date was dated 2018-01-24, with a file datestamp of 2018-01-19.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: N/A
AEROSPACI score: 0.34 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: vacuolar protein sorting protein 36
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Database cross-references and differences (RAF-indexed):
    • PDB 2CAY (Start-7)
    • Uniprot Q06696 (107-End)
    Domains in SCOPe 2.08: d2caya1, d2caya2
  • Chain 'B':
    Compound: vacuolar protein sorting protein 36
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Database cross-references and differences (RAF-indexed):
    • PDB 2CAY (Start-7)
    • Uniprot Q06696 (107-End)
    Domains in SCOPe 2.08: d2cayb1, d2cayb2
  • Heterogens: SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2cayA (A:)
    mahhhhhhmeywhyvettssgqpllregekdifidqsvglyhgkskilqrqrgrifltsq
    riiyiddakptqnslglelddlayvnyssgfltrsprlilffkdpssstefvqlsfrksd
    gvlfsqateralenilteknkhifn
    

    Sequence, based on observed residues (ATOM records): (download)
    >2cayA (A:)
    hhmeywhyvettssgqpllregekdifidqsvglyhgkskilqrqrgrifltsqriiyid
    dakptqnslglelddlayvnyssgfltrsprlilffkdpssstefvqlsfrksdgvlfsq
    ateralenilte
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2cayB (B:)
    mahhhhhhmeywhyvettssgqpllregekdifidqsvglyhgkskilqrqrgrifltsq
    riiyiddakptqnslglelddlayvnyssgfltrsprlilffkdpssstefvqlsfrksd
    gvlfsqateralenilteknkhifn
    

    Sequence, based on observed residues (ATOM records): (download)
    >2cayB (B:)
    hhmeywhyvettssgqpllregekdifidqsvglyhgkskilqrqrgrifltsqriiyid
    dakptqnslglelddlayvnyssgfltrsprlilffkdpssstefvqlsfrksdgvlfsq
    ateralenilt