PDB entry 2cax
View 2cax on RCSB PDB site
Description: structural basis for cooperative binding of ribbon-helix-helix repressor omega to mutated direct DNA heptad repeats
Class: transcriptional repressor
Keywords: transcriptional repressor, inc18 family of plasmids, rhh, metj/arc superfamily, cooperative DNA binding, DNA heptad 5'- a/t atcac a/t -3', plasmid maintenance, DNA- binding, regulatory protein
Deposited on
2005-12-23, released
2006-03-15
The last revision prior to the SCOPe 2.03 freeze date was dated
2011-07-13, with a file datestamp of
2011-05-31.
Experiment type: XRAY
Resolution: 2.9 Å
R-factor: 0.21
AEROSPACI score: 0.24
(click here for full SPACI score report)
Chains and heterogens:
- Chain 'A':
Compound: orf omega
Species: Streptococcus pyogenes [TaxId:1314]
Database cross-references and differences (RAF-indexed):
Domains in SCOPe 2.03: d2caxa_ - Chain 'B':
Compound: orf omega
Species: Streptococcus pyogenes [TaxId:1314]
Database cross-references and differences (RAF-indexed):
Domains in SCOPe 2.03: d2caxb_ - Chain 'C':
Compound: orf omega
Species: Streptococcus pyogenes [TaxId:1314]
Database cross-references and differences (RAF-indexed):
Domains in SCOPe 2.03: d2caxc_ - Chain 'D':
Compound: orf omega
Species: Streptococcus pyogenes [TaxId:1314]
Database cross-references and differences (RAF-indexed):
Domains in SCOPe 2.03: d2caxd_ - Chain 'G':
Compound: 5'-d(*gp*ap*ap*tp*cp*ap*cp*ap*ap*ap *tp*cp*ap*cp*ap*ap*g)-3'
- Chain 'H':
Compound: 5'-d(*tp*tp*gp*tp*gp*ap*tp*tp*tp*gp *tp*gp*ap*tp*tp*cp*g)-3'
Species: synthetic, synthetic
- Chain 'U':
Compound: 5'-d(*gp*ap*ap*tp*cp*ap*cp*ap*ap*gp *tp*cp*ap*cp*ap*ap*gp*c)-3'
- Chain 'Y':
Compound: 5'-d(*cp*tp*tp*gp*tp*gp*ap*cp*tp*tp *gp*tp*gp*ap*tp*tp*cp*g)-3'
Species: synthetic, synthetic
- Heterogens: HOH
PDB Chain Sequences:
- Chain 'A':
Sequence; same for both SEQRES and ATOM records: (download)
>2caxA (A:)
makkdimgdktvrvradlhhiikietaknggnvkevmdqaleeyirkylpdkl
- Chain 'B':
Sequence, based on SEQRES records: (download)
>2caxB (B:)
makkdimgdktvrvradlhhiikietaknggnvkevmdqaleeyirkylpdkl
Sequence, based on observed residues (ATOM records): (download)
>2caxB (B:)
kdimgdktvrvradlhhiikietaknggnvkevmdqaleeyirkylpdkl
- Chain 'C':
Sequence; same for both SEQRES and ATOM records: (download)
>2caxC (C:)
makkdimgdktvrvradlhhiikietaknggnvkevmdqaleeyirkylpdkl
- Chain 'D':
Sequence, based on SEQRES records: (download)
>2caxD (D:)
makkdimgdktvrvradlhhiikietaknggnvkevmdqaleeyirkylpdkl
Sequence, based on observed residues (ATOM records): (download)
>2caxD (D:)
mgdktvrvradlhhiikietaknggnvkevmdqaleeyirkylpdkl
- Chain 'G':
No sequence available.
- Chain 'H':
No sequence available.
- Chain 'U':
No sequence available.
- Chain 'Y':
No sequence available.