PDB entry 2cax

View 2cax on RCSB PDB site
Description: structural basis for cooperative binding of ribbon-helix-helix repressor omega to mutated direct DNA heptad repeats
Class: transcriptional repressor
Keywords: transcriptional repressor, inc18 family of plasmids, rhh, metj/arc superfamily, cooperative DNA binding, DNA heptad 5'- a/t atcac a/t -3', plasmid maintenance, DNA- binding, regulatory protein
Deposited on 2005-12-23, released 2006-03-15
The last revision prior to the SCOPe 2.03 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-31.
Experiment type: XRAY
Resolution: 2.9 Å
R-factor: 0.21
AEROSPACI score: 0.24 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: orf omega
    Species: Streptococcus pyogenes [TaxId:1314]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q57468 (1-52)
      • expression tag (0)
    Domains in SCOPe 2.03: d2caxa_
  • Chain 'B':
    Compound: orf omega
    Species: Streptococcus pyogenes [TaxId:1314]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d2caxb_
  • Chain 'C':
    Compound: orf omega
    Species: Streptococcus pyogenes [TaxId:1314]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q57468 (1-52)
      • expression tag (0)
    Domains in SCOPe 2.03: d2caxc_
  • Chain 'D':
    Compound: orf omega
    Species: Streptococcus pyogenes [TaxId:1314]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d2caxd_
  • Chain 'G':
    Compound: 5'-d(*gp*ap*ap*tp*cp*ap*cp*ap*ap*ap *tp*cp*ap*cp*ap*ap*g)-3'
  • Chain 'H':
    Compound: 5'-d(*tp*tp*gp*tp*gp*ap*tp*tp*tp*gp *tp*gp*ap*tp*tp*cp*g)-3'
    Species: synthetic, synthetic
  • Chain 'U':
    Compound: 5'-d(*gp*ap*ap*tp*cp*ap*cp*ap*ap*gp *tp*cp*ap*cp*ap*ap*gp*c)-3'
  • Chain 'Y':
    Compound: 5'-d(*cp*tp*tp*gp*tp*gp*ap*cp*tp*tp *gp*tp*gp*ap*tp*tp*cp*g)-3'
    Species: synthetic, synthetic
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2caxA (A:)
    makkdimgdktvrvradlhhiikietaknggnvkevmdqaleeyirkylpdkl
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2caxB (B:)
    makkdimgdktvrvradlhhiikietaknggnvkevmdqaleeyirkylpdkl
    

    Sequence, based on observed residues (ATOM records): (download)
    >2caxB (B:)
    kdimgdktvrvradlhhiikietaknggnvkevmdqaleeyirkylpdkl
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2caxC (C:)
    makkdimgdktvrvradlhhiikietaknggnvkevmdqaleeyirkylpdkl
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >2caxD (D:)
    makkdimgdktvrvradlhhiikietaknggnvkevmdqaleeyirkylpdkl
    

    Sequence, based on observed residues (ATOM records): (download)
    >2caxD (D:)
    mgdktvrvradlhhiikietaknggnvkevmdqaleeyirkylpdkl
    

  • Chain 'G':
    No sequence available.

  • Chain 'H':
    No sequence available.

  • Chain 'U':
    No sequence available.

  • Chain 'Y':
    No sequence available.