PDB entry 2cax

View 2cax on RCSB PDB site
Description: structural basis for cooperative binding of ribbon-helix-helix repressor omega to mutated direct DNA heptad repeats
Class: transcriptional repressor
Keywords: transcriptional repressor, inc18 family of plasmids, rhh, metj/arc superfamily, cooperative DNA binding, DNA heptad 5'- a/t atcac a/t -3', plasmid maintenance, DNA- binding, regulatory protein
Deposited on 2005-12-23, released 2006-03-15
The last revision prior to the SCOPe 2.02 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-31.
Experiment type: XRAY
Resolution: 2.9 Å
R-factor: 0.21
AEROSPACI score: 0.24 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: orf omega
  Species: Streptococcus pyogenes [TaxId:1314]
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q57468 (1-52)
    • expression tag (0)
  Domains in SCOPe 2.02: d2caxa_
• Chain 'B':
  Compound: orf omega
  Species: Streptococcus pyogenes [TaxId:1314]
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q57468 (Start-52)
  Domains in SCOPe 2.02: d2caxb_
• Chain 'C':
  Compound: orf omega
  Species: Streptococcus pyogenes [TaxId:1314]
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q57468 (1-52)
    • expression tag (0)
  Domains in SCOPe 2.02: d2caxc_
• Chain 'D':
  Compound: orf omega
  Species: Streptococcus pyogenes [TaxId:1314]
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q57468 (Start-52)
  Domains in SCOPe 2.02: d2caxd_
• Chain 'G':
  Compound: 5'-d(*gp*ap*ap*tp*cp*ap*cp*ap*ap*ap *tp*cp*ap*cp*ap*ap*g)-3'
  
• Chain 'H':
  Compound: 5'-d(*tp*tp*gp*tp*gp*ap*tp*tp*tp*gp *tp*gp*ap*tp*tp*cp*g)-3'
  Species: synthetic, synthetic
  
• Chain 'U':
  Compound: 5'-d(*gp*ap*ap*tp*cp*ap*cp*ap*ap*gp *tp*cp*ap*cp*ap*ap*gp*c)-3'
  
• Chain 'Y':
  Compound: 5'-d(*cp*tp*tp*gp*tp*gp*ap*cp*tp*tp *gp*tp*gp*ap*tp*tp*cp*g)-3'
  Species: synthetic, synthetic
  
• Heterogens: HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >2caxA (A:)
  makkdimgdktvrvradlhhiikietaknggnvkevmdqaleeyirkylpdkl
  

  
  
• Chain 'B':
  Sequence, based on SEQRES records: (download)
  

  >2caxB (B:)
  makkdimgdktvrvradlhhiikietaknggnvkevmdqaleeyirkylpdkl
  

  
  Sequence, based on observed residues (ATOM records): (download)
  

  >2caxB (B:)
  kdimgdktvrvradlhhiikietaknggnvkevmdqaleeyirkylpdkl
  

  
  
• Chain 'C':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >2caxC (C:)
  makkdimgdktvrvradlhhiikietaknggnvkevmdqaleeyirkylpdkl
  

  
  
• Chain 'D':
  Sequence, based on SEQRES records: (download)
  

  >2caxD (D:)
  makkdimgdktvrvradlhhiikietaknggnvkevmdqaleeyirkylpdkl
  

  
  Sequence, based on observed residues (ATOM records): (download)
  

  >2caxD (D:)
  mgdktvrvradlhhiikietaknggnvkevmdqaleeyirkylpdkl
  

  
  
• Chain 'G':
  No sequence available.
  
  
• Chain 'H':
  No sequence available.
  
  
• Chain 'U':
  No sequence available.
  
  
• Chain 'Y':
  No sequence available.