PDB entry 2cau

View 2cau on RCSB PDB site
Description: canavalin from jack bean
Deposited on 1998-11-20, released 1998-11-25
The last revision prior to the SCOP 1.71 freeze date was dated 2000-05-05, with a file datestamp of 2000-05-05.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.175
AEROSPACI score: 0.41 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2cauA (A:)
    mafsarfplwlllgvvllasvsasfahsghsggeaedeseesraqnnpylfrsnkfltlf
    knqhgslrllqrfnedteklenlrdyrvleycskpntlllphhsdsdllvlvlegqailv
    lvnpdgrdtykldqgdaikiqagtpfylinpdnnqnlrilkfaitfrrpgtvedfflsst
    krlpsylsafsknfleasydspydeieqtllqeeqegvivkmpkdqiqeiskhaqsssrk
    tlssqdkpfnlrsrdpiysnnygklyeitpeknsqlrdldillnclqmnegalfvphyns
    ratvilvanegraevelvgleqqqqqglesmqlrryaatlsegdiivipssfpvalkaas
    dlnmvgigvnaennernflaghkenvirqiprqvsdltfpgsgeeveellenqkesyfvd
    gqprhidaggkarrahlpnlfrtfy
    

    Sequence, based on observed residues (ATOM records): (download)
    >2cauA (A:)
    nnpylfrsnkfltlfknqhgslrllqrfnedteklenlrdyrvleycskpntlllphhsd
    sdllvlvlegqailvlvnpdgrdtykldqgdaikiqagtpfylinpdnnqnlrilkfait
    frrpgtvedfflsstkrlpsylsafsknfleasydspydeieqtllqeeqegvivkmpdk
    pfnlrsrdpiysnnygklyeitpeknsqlrdldillnclqmnegalfvphynsratvilv
    anegraevelvgleqlrryaatlsegdiivipssfpvalkaasdlnmvgigvnaennern
    flaghkenvirqiprqvsdltfpgsgeeveellenqkesyfvdg