PDB entry 2caq

View 2caq on RCSB PDB site
Description: Structure of R21L mutant of Sh28GST in complex with GSH
Class: transferase
Keywords: sigma class gst, detoxification, glutathione, prostaglandin d2 synthase, transferase, antigen
Deposited on 2005-12-22, released 2006-06-21
The last revision prior to the SCOPe 2.07 freeze date was dated 2013-05-08, with a file datestamp of 2013-05-03.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.19
AEROSPACI score: 0.44 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: glutathione s-transferase 28 kda
    Species: SCHISTOSOMA HAEMATOBIUM [TaxId:6185]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P30113
      • engineered mutation (20)
    Domains in SCOPe 2.07: d2caqa1, d2caqa2
  • Heterogens: GSH, PG4, BME, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2caqA (A:)
    mtgdhikviyfngrgraesilmtlvaagvnyederisfqdwpkikptipggrlpavkitd
    nhghvkwmveslaiarymakkhhmmggteeeyynvekligqaedleheyyktlmkpeeek
    qkiikeilngkvpvlldiiceslkastgklavgdkvtladlvliavidhvtdldkefltg
    kypeihkhrenllassprlakylsdraatpf
    

    Sequence, based on observed residues (ATOM records): (download)
    >2caqA (A:)
    dhikviyfngrgraesilmtlvaagvnyederisfqdwpkikptipggrlpavkitdnhg
    hvkwmveslaiarymakkhhmmggteeeyynvekligqaedleheyyktlmkpeeekqki
    ikeilngkvpvlldiiceslkastgklavgdkvtladlvliavidhvtdldkefltgkyp
    eihkhrenllassprlakylsdra