PDB entry 2cam

View 2cam on RCSB PDB site
Description: avidin mutant (k3e,k9e,r26d,r124l)
Class: glycoprotein
Keywords: avidin, biotin binding protein, calycins, up-and-down beta barrel, glycoprotein
Deposited on 1998-03-27, released 1998-07-15
The last revision prior to the SCOPe 2.05 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.181
AEROSPACI score: 0.39 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Avidin
    Species: Gallus gallus [TaxId:9031]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P02701 (0-End)
      • engineered (1)
      • engineered (7)
      • engineered (24)
      • engineered (122)
    Domains in SCOPe 2.05: d2cama_
  • Chain 'B':
    Compound: Avidin
    Species: Gallus gallus [TaxId:9031]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P02701 (0-End)
      • engineered (1)
      • engineered (7)
      • engineered (24)
      • engineered (122)
    Domains in SCOPe 2.05: d2camb_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2camA (A:)
    recsltgewtndlgsnmtigavnsdgeftgtyitavtatsneikesplhgtentinkrtq
    ptfgftvnwkfsesttvftgqcfidrngkevlktmwllrssvndigddwkatrvginift
    rlltqke
    

    Sequence, based on observed residues (ATOM records): (download)
    >2camA (A:)
    recsltgewtndlgsnmtigavnsdgeftgtyitavtatsneikesplhgtentinkrtq
    ptfgftvnwkfsesttvftgqcfidrngkevlktmwllrssvndigddwkatrvginift
    rllt
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2camB (B:)
    recsltgewtndlgsnmtigavnsdgeftgtyitavtatsneikesplhgtentinkrtq
    ptfgftvnwkfsesttvftgqcfidrngkevlktmwllrssvndigddwkatrvginift
    rlltqke
    

    Sequence, based on observed residues (ATOM records): (download)
    >2camB (B:)
    recsltgewtndlgsnmtigavnsdgeftgtyitavtatsneikesplhgtentinkrtq
    ptfgftvnwkfsesttvftgqcfidrngkevlktmwllrssvndigddwkatrvginift
    rllt