PDB entry 2cam

View 2cam on RCSB PDB site
Description: avidin mutant (k3e,k9e,r26d,r124l)
Deposited on 1998-03-27, released 1998-07-15
The last revision prior to the SCOP 1.67 freeze date was dated 1998-07-15, with a file datestamp of 1998-07-15.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.181
AEROSPACI score: 0.39 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.67: d2cama_
  • Chain 'B':
    Domains in SCOP 1.67: d2camb_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2camA (A:)
    recsltgewtndlgsnmtigavnsdgeftgtyitavtatsneikesplhgtentinkrtq
    ptfgftvnwkfsesttvftgqcfidrngkevlktmwllrssvndigddwkatrvginift
    rlltqke
    

    Sequence, based on observed residues (ATOM records): (download)
    >2camA (A:)
    recsltgewtndlgsnmtigavnsdgeftgtyitavtatsneikesplhgtentinkrtq
    ptfgftvnwkfsesttvftgqcfidrngkevlktmwllrssvndigddwkatrvginift
    rllt
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2camB (B:)
    recsltgewtndlgsnmtigavnsdgeftgtyitavtatsneikesplhgtentinkrtq
    ptfgftvnwkfsesttvftgqcfidrngkevlktmwllrssvndigddwkatrvginift
    rlltqke
    

    Sequence, based on observed residues (ATOM records): (download)
    >2camB (B:)
    recsltgewtndlgsnmtigavnsdgeftgtyitavtatsneikesplhgtentinkrtq
    ptfgftvnwkfsesttvftgqcfidrngkevlktmwllrssvndigddwkatrvginift
    rllt