PDB entry 2cag

View 2cag on RCSB PDB site
Description: catalase compound II
Class: oxidoreductase (h2o2 acceptor)
Keywords: oxidoreductase (h2o2 acceptor), peroxidase, iron, heme, hydrogen peroxide, nadp
Deposited on 1996-06-12, released 1996-12-07
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.7 Å
R-factor: 0.179
AEROSPACI score: 0.3 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: catalase compound II
    Species: Proteus mirabilis [TaxId:584]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P42321
      • conflict (52)
    Domains in SCOPe 2.07: d2caga_
  • Heterogens: HEM, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2cagA (A:)
    mekkklttaagapvvdnnnvitagprgpmllqdvwfleklahfdreviperrmhakgsga
    fgtftvthditkytrakifsevgkktemfarfstvagergaadaerdirgfalkfyteeg
    nwdmvgnntpvfylrdplkfpdlnhivkrdprtnmrnmaykwdffshlpeslhqltidms
    drglplsyrfvhgfgshtysfinkdnerfwvkfhfrcqqgiknlmddeaealvgkdress
    qrdlfeaiergdyprwklqiqimpekeastvpynpfdltkvwphadyplmdvgyfelnrn
    pdnyfsdveqaafspanivpgisfspdkmlqgrlfsygdahryrlgvnhhqipvnapkcp
    fhnyhrdgamrvdgnsgngityepnsggvfqeqpdfkepplsiegaadhwnhrededyfs
    qpralyellsddehqrmfariagelsqasketqqrqidlftkvhpeygagvekaikvleg
    kdak
    

    Sequence, based on observed residues (ATOM records): (download)
    >2cagA (A:)
    kklttaagapvvdnnnvitagprgpmllqdvwfleklahfdreviperrmhakgsgafgt
    ftvthditkytrakifsevgkktemfarfstvagergaadaerdirgfalkfyteegnwd
    mvgnntpvfylrdplkfpdlnhivkrdprtnmrnmaykwdffshlpeslhqltidmsdrg
    lplsyrfvhgfgshtysfinkdnerfwvkfhfrcqqgiknlmddeaealvgkdressqrd
    lfeaiergdyprwklqiqimpekeastvpynpfdltkvwphadyplmdvgyfelnrnpdn
    yfsdveqaafspanivpgisfspdkmlqgrlfsygdahryrlgvnhhqipvnapkcpfhn
    yhrdgamrvdgnsgngityepnsggvfqeqpdfkepplsiegaadhwnhrededyfsqpr
    alyellsddehqrmfariagelsqasketqqrqidlftkvhpeygagvekaikvl