PDB entry 2cag

View 2cag on RCSB PDB site
Description: catalase compound ii
Deposited on 1996-06-12, released 1996-12-07
The last revision prior to the SCOP 1.59 freeze date was dated 1996-12-07, with a file datestamp of 1996-12-08.
Experiment type: XRAY
Resolution: 2.7 Å
R-factor: 0.179
AEROSPACI score: 0.31 (click here for full SPACI score report)

Chains and heterogens:

  • Chain ' ':
    Domains in SCOP 1.59: d2cag__

PDB Chain Sequences:

  • Chain ' ':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2cag_ (-)
    kklttaagapvvdnnnvitagprgpmllqdvwfleklahfdreviperrmhakgsgafgt
    ftvthditkytrakifsevgkktemfarfstvagergaadaerdirgfalkfyteegnwd
    mvgnntpvfylrdplkfpdlnhivkrdprtnmrnmaykwdffshlpeslhqltidmsdrg
    lplsyrfvhgfgshtysfinkdnerfwvkfhfrcqqgiknlmddeaealvgkdressqrd
    lfeaiergdyprwklqiqimpekeastvpynpfdltkvwphadyplmdvgyfelnrnpdn
    yfsdveqaafspanivpgisfspdkmlqgrlfsygdahryrlgvnhhqipvnapkcpfhn
    yhrdgamrvdgnsgngityepnsggvfqeqpdfkepplsiegaadhwnhrededyfsqpr
    alyellsddehqrmfariagelsqasketqqrqidlftkvhpeygagvekaikvl