PDB entry 2ca8

View 2ca8 on RCSB PDB site
Description: Structure of Sh28GST in complex with GSH at pH 6.0
Class: transferase
Keywords: sigma class gst, detoxification, glutathione, prostaglandin d2 synthase, transferase
Deposited on 2005-12-20, released 2006-06-26
The last revision prior to the SCOPe 2.08 freeze date was dated 2013-04-17, with a file datestamp of 2013-04-12.
Experiment type: XRAY
Resolution: 2.49 Å
R-factor: 0.20600000000000004
AEROSPACI score: 0.32 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: glutathione s-transferase 28 kda
    Species: SCHISTOSOMA HAEMATOBIUM [TaxId:6185]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d2ca8a1, d2ca8a2
  • Heterogens: GSH, PG4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2ca8A (A:)
    mtgdhikviyfngrgraesirmtlvaagvnyederisfqdwpkikptipggrlpavkitd
    nhghvkwmveslaiarymakkhhmmggteeeyynvekligqaedleheyyktlmkpeeek
    qkiikeilngkvpvlldiiceslkastgklavgdkvtladlvliavidhvtdldkefltg
    kypeihkhrenllassprlakylsdraatpf
    

    Sequence, based on observed residues (ATOM records): (download)
    >2ca8A (A:)
    dhikviyfngrgraesirmtlvaagvnyederisfqdwpkikptipggrlpavkitdnhg
    hvkwmveslaiarymakkhhmmggteeeyynvekligqaedleheyyktlmkpeeekqki
    ikeilngkvpvlldiiceslkastgklavgdkvtladlvliavidhvtdldkefltgkyp
    eihkhrenllassprlakylsdraatpf