PDB entry 2ca5

View 2ca5 on RCSB PDB site
Description: mxih needle protein of shigella flexneri (monomeric form, residues 1-78)
Class: transport protein
Keywords: transport protein, mxih, type III secretion system, needle complex, protein transport, virulence
Deposited on 2005-12-16, released 2006-08-07
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.194
AEROSPACI score: 0.43 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: mxih
    Species: SHIGELLA FLEXNERI [TaxId:623]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0A223 (Start-77)
    • PDB 2CA5 (78-End)
    Domains in SCOPe 2.07: d2ca5a1, d2ca5a2
  • Chain 'B':
    Compound: mxih
    Species: SHIGELLA FLEXNERI [TaxId:623]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2ca5b_
  • Heterogens: IPA, GOL, NA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2ca5A (A:)
    msvtvpnddwtlsslsetfddgtqtlqgeltlaldklaknpsnpqllaeyqsklseytly
    rnaqsntvkvikdvdaailehhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >2ca5A (A:)
    ddgtqtlqgeltlaldklaknpsnpqllaeyqsklseytlyrnaqsntvkvikdvdaail
    eh
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2ca5B (B:)
    msvtvpnddwtlsslsetfddgtqtlqgeltlaldklaknpsnpqllaeyqsklseytly
    rnaqsntvkvikdvdaailehhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >2ca5B (B:)
    lsetfddgtqtlqgeltlaldklaknpsnpqllaeyqsklseytlyrnaqsntvkvikdv
    d