PDB entry 2c9w

View 2c9w on RCSB PDB site
Description: crystal structure of socs-2 in complex with elongin-b and elongin-c at 1.9a resolution
Class: transcription regulation
Keywords: growth regulation, sh2 domain, signal transduction inhibitor, nuclear protein, transcription, transcription regulation, ubl conjugation pathway
Deposited on 2005-12-14, released 2006-02-22
The last revision prior to the SCOPe 2.03 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-31.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.187
AEROSPACI score: 0.49 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: suppressor of cytokine signaling 2
    Species: Homo sapiens [TaxId:9606]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • PDB 2C9W
    • Uniprot O14508 (2-168)
    Domains in SCOPe 2.03: d2c9wa1, d2c9wa2
  • Chain 'B':
    Compound: Transcription elongation factor B polypeptide 2
    Species: Homo sapiens [TaxId:9606]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d2c9wb_
  • Chain 'C':
    Compound: Transcription elongation factor B polypeptide 1
    Species: Homo sapiens [TaxId:9606]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • PDB 2C9W
    • Uniprot Q15369 (1-96)
    Domains in SCOPe 2.03: d2c9wc_
  • Heterogens: SO4, NI, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2c9wA (A:)
    smqaarlakalrelgqtgwywgsmtvneakeklkeapegtflirdsshsdylltisvkts
    agptnlrieyqdgkfrldsiicvksklkqfdsvvhlidyyvqmckdkrtgpeaprngtvh
    lyltkplytsapslqhlcrltinkctgaiwglplptrlkdyleeykfqv
    

    Sequence, based on observed residues (ATOM records): (download)
    >2c9wA (A:)
    qaarlakalrelgqtgwywgsmtvneakeklkeapegtflirdsshsdylltisvktsag
    ptnlrieyqdgkfrldsiicvksklkqfdsvvhlidyyvqmckhlyltkplytsapslqh
    lcrltinkctgaiwglplptrlkdyleeykfqv
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2c9wB (B:)
    mdvflmirrhkttiftdakesstvfelkrivegilkrppdeqrlykddqllddgktlgec
    gftsqtarpqapatvglafraddtfealciepfssppelpdvmkpqdsgssaneqavq
    

    Sequence, based on observed residues (ATOM records): (download)
    >2c9wB (B:)
    dvflmirrhkttiftdakesstvfelkrivegilkrppdeqrlykddqllddgktlgecg
    ftsqtarpqapatvglafraddtfealciepfssppelpdvmk
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >2c9wC (C:)
    mmyvklissdghefivkrehaltsgtikamlsgpgqfaenetnevnfreipshvlskvcm
    yftykvrytnssteipefpiapeialellmaanfldc
    

    Sequence, based on observed residues (ATOM records): (download)
    >2c9wC (C:)
    myvklissdghefivkrehaltsgtikamnevnfreipshvlskvcmyftykvryteipe
    fpiapeialellmaanfldc