PDB entry 2c9l

View 2c9l on RCSB PDB site
Description: structure of the epstein-barr virus zebra protein
Class: viral protein
Keywords: viral protein, epstein-barr virus, ebv, zebra, bzlf1, zta, z, lytic cycle activation, bzip protein, viral protein DNA-binding, nuclear protein, transcription regulation
Deposited on 2005-12-13, released 2006-02-21
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.25 Å
R-factor: 0.2317
AEROSPACI score: 0.36 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 5'-d(*ap*ap*gp*cp*ap*cp*tp*gp*ap*cp *tp*cp*ap*tp*gp*ap*ap*gp*t)-3'
    Species: HUMAN HERPESVIRUS 4, synthetic [TaxId:10376]
  • Chain 'B':
    Compound: 5'-d(*ap*cp*tp*tp*cp*ap*cp*tp*gp*ap *gp*tp*cp*ap*gp*tp*gp*cp*t)-3'
    Species: HUMAN HERPESVIRUS 4, synthetic [TaxId:10376]
  • Chain 'Y':
    Compound: bzlf1 trans-activator protein
    Species: HUMAN HERPESVIRUS 4 [TaxId:10376]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d2c9ly1
  • Chain 'Z':
    Compound: bzlf1 trans-activator protein
    Species: HUMAN HERPESVIRUS 4 [TaxId:10376]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d2c9lz1
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'B':
    No sequence available.

  • Chain 'Y':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2c9lY (Y:)
    mleikryknrvaarksrakfkqllqhyrevaaakssendrlrlllkqmcpsldvdsiipr
    tpd
    

  • Chain 'Z':
    Sequence, based on SEQRES records: (download)
    >2c9lZ (Z:)
    mleikryknrvaarksrakfkqllqhyrevaaakssendrlrlllkqmcpsldvdsiipr
    tpd
    

    Sequence, based on observed residues (ATOM records): (download)
    >2c9lZ (Z:)
    leikryknrvaarksrakfkqllqhyrevaaakssendrlrlllkqmcpsldvdsiiprt
    pd