PDB entry 2c9j

View 2c9j on RCSB PDB site
Description: structure of the fluorescent protein cmfp512 at 1.35a from cerianthus membranaceus
Class: luminescent protein
Keywords: fluorescent protein, beta-barrel, bioluminescence, luminescence, luminescent protein
Deposited on 2005-12-12, released 2006-10-30
The last revision prior to the SCOPe 2.01 freeze date was dated 2009-06-23, with a file datestamp of 2009-06-19.
Experiment type: XRAY
Resolution: 1.35 Å
R-factor: 0.229
AEROSPACI score: 0.64 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: green fluorescent protein fp512
    Species: CERIANTHUS MEMBRANACEUS [TaxId:208460]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q5ZQQ5
      • chromophore (61)
    Domains in SCOPe 2.01: d2c9ja_
  • Chain 'B':
    Compound: green fluorescent protein fp512
    Species: CERIANTHUS MEMBRANACEUS [TaxId:208460]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q5ZQQ5
      • chromophore (61)
    Domains in SCOPe 2.01: d2c9jb_
  • Chain 'C':
    Compound: green fluorescent protein fp512
    Species: CERIANTHUS MEMBRANACEUS [TaxId:208460]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q5ZQQ5
      • chromophore (61)
    Domains in SCOPe 2.01: d2c9jc_
  • Chain 'D':
    Compound: green fluorescent protein fp512
    Species: CERIANTHUS MEMBRANACEUS [TaxId:208460]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q5ZQQ5
      • chromophore (61)
    Domains in SCOPe 2.01: d2c9jd_
  • Chain 'E':
    Compound: green fluorescent protein fp512
    Species: CERIANTHUS MEMBRANACEUS [TaxId:208460]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q5ZQQ5
      • chromophore (61)
    Domains in SCOPe 2.01: d2c9je_
  • Chain 'F':
    Compound: green fluorescent protein fp512
    Species: CERIANTHUS MEMBRANACEUS [TaxId:208460]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q5ZQQ5
      • chromophore (61)
    Domains in SCOPe 2.01: d2c9jf_
  • Chain 'G':
    Compound: green fluorescent protein fp512
    Species: CERIANTHUS MEMBRANACEUS [TaxId:208460]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q5ZQQ5
      • chromophore (61)
    Domains in SCOPe 2.01: d2c9jg_
  • Chain 'H':
    Compound: green fluorescent protein fp512
    Species: CERIANTHUS MEMBRANACEUS [TaxId:208460]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q5ZQQ5
      • chromophore (61)
    Domains in SCOPe 2.01: d2c9jh_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2c9jA (A:)
    msqldnnlsvsvymkgnvnnhefeydgigggdpnsgqfslktklrggkplpfsydiitmg
    fqygfraftkypegiadyfkgsfpeafqwnrriefedggvinmssditykdkvlhgdvwa
    lgvnfppngpvmkneivmeepaeetltakngvlvgfcpkayllkdgsyyyghmttfyrsk
    ksgqplpgfhfikhrlvktkvepgfkmveqaeyatahvcdlpkpn
    

    Sequence, based on observed residues (ATOM records): (download)
    >2c9jA (A:)
    nlsvsvymkgnvnnhefeydgigggdpnsgqfslktklrggkplpfsydiitmgfqygfr
    aftkypegiadyfkgsfpeafqwnrriefedggvinmssditykdkvlhgdvwalgvnfp
    pngpvmkneivmeepaeetltakngvlvgfcpkayllkdgsyyyghmttfyrskksgqpl
    pgfhfikhrlvktkvepgfkmveqaeyatahvcdlp
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2c9jB (B:)
    msqldnnlsvsvymkgnvnnhefeydgigggdpnsgqfslktklrggkplpfsydiitmg
    fqygfraftkypegiadyfkgsfpeafqwnrriefedggvinmssditykdkvlhgdvwa
    lgvnfppngpvmkneivmeepaeetltakngvlvgfcpkayllkdgsyyyghmttfyrsk
    ksgqplpgfhfikhrlvktkvepgfkmveqaeyatahvcdlpkpn
    

    Sequence, based on observed residues (ATOM records): (download)
    >2c9jB (B:)
    ldnnlsvsvymkgnvnnhefeydgigggdpnsgqfslktklrggkplpfsydiitmgfqy
    gfraftkypegiadyfkgsfpeafqwnrriefedggvinmssditykdkvlhgdvwalgv
    nfppngpvmkneivmeepaeetltakngvlvgfcpkayllkdgsyyyghmttfyrskksg
    qplpgfhfikhrlvktkvepgfkmveqaeyatahvcdlpk
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >2c9jC (C:)
    msqldnnlsvsvymkgnvnnhefeydgigggdpnsgqfslktklrggkplpfsydiitmg
    fqygfraftkypegiadyfkgsfpeafqwnrriefedggvinmssditykdkvlhgdvwa
    lgvnfppngpvmkneivmeepaeetltakngvlvgfcpkayllkdgsyyyghmttfyrsk
    ksgqplpgfhfikhrlvktkvepgfkmveqaeyatahvcdlpkpn
    

    Sequence, based on observed residues (ATOM records): (download)
    >2c9jC (C:)
    ldnnlsvsvymkgnvnnhefeydgigggdpnsgqfslktklrggkplpfsydiitmgfqy
    gfraftkypegiadyfkgsfpeafqwnrriefedggvinmssditykdkvlhgdvwalgv
    nfppngpvmkneivmeepaeetltakngvlvgfcpkayllkdgsyyyghmttfyrskksg
    qplpgfhfikhrlvktkvepgfkmveqaeyatahvcdlpk
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >2c9jD (D:)
    msqldnnlsvsvymkgnvnnhefeydgigggdpnsgqfslktklrggkplpfsydiitmg
    fqygfraftkypegiadyfkgsfpeafqwnrriefedggvinmssditykdkvlhgdvwa
    lgvnfppngpvmkneivmeepaeetltakngvlvgfcpkayllkdgsyyyghmttfyrsk
    ksgqplpgfhfikhrlvktkvepgfkmveqaeyatahvcdlpkpn
    

    Sequence, based on observed residues (ATOM records): (download)
    >2c9jD (D:)
    ldnnlsvsvymkgnvnnhefeydgigggdpnsgqfslktklrggkplpfsydiitmgfqy
    gfraftkypegiadyfkgsfpeafqwnrriefedggvinmssditykdkvlhgdvwalgv
    nfppngpvmkneivmeepaeetltakngvlvgfcpkayllkdgsyyyghmttfyrskksg
    qplpgfhfikhrlvktkvepgfkmveqaeyatahvcdlpkp
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >2c9jE (E:)
    msqldnnlsvsvymkgnvnnhefeydgigggdpnsgqfslktklrggkplpfsydiitmg
    fqygfraftkypegiadyfkgsfpeafqwnrriefedggvinmssditykdkvlhgdvwa
    lgvnfppngpvmkneivmeepaeetltakngvlvgfcpkayllkdgsyyyghmttfyrsk
    ksgqplpgfhfikhrlvktkvepgfkmveqaeyatahvcdlpkpn
    

    Sequence, based on observed residues (ATOM records): (download)
    >2c9jE (E:)
    dnnlsvsvymkgnvnnhefeydgigggdpnsgqfslktklrggkplpfsydiitmgfqyg
    fraftkypegiadyfkgsfpeafqwnrriefedggvinmssditykdkvlhgdvwalgvn
    fppngpvmkneivmeepaeetltakngvlvgfcpkayllkdgsyyyghmttfyrskksgq
    plpgfhfikhrlvktkvepgfkmveqaeyatahvcdlpkp
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >2c9jF (F:)
    msqldnnlsvsvymkgnvnnhefeydgigggdpnsgqfslktklrggkplpfsydiitmg
    fqygfraftkypegiadyfkgsfpeafqwnrriefedggvinmssditykdkvlhgdvwa
    lgvnfppngpvmkneivmeepaeetltakngvlvgfcpkayllkdgsyyyghmttfyrsk
    ksgqplpgfhfikhrlvktkvepgfkmveqaeyatahvcdlpkpn
    

    Sequence, based on observed residues (ATOM records): (download)
    >2c9jF (F:)
    nlsvsvymkgnvnnhefeydgigggdpnsgqfslktklrggkplpfsydiitmgfqygfr
    aftkypegiadyfkgsfpeafqwnrriefedggvinmssditykdkvlhgdvwalgvnfp
    pngpvmkneivmeepaeetltakngvlvgfcpkayllkdgsyyyghmttfyrskksgqpl
    pgfhfikhrlvktkvepgfkmveqaeyatahvcdlpkp
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >2c9jG (G:)
    msqldnnlsvsvymkgnvnnhefeydgigggdpnsgqfslktklrggkplpfsydiitmg
    fqygfraftkypegiadyfkgsfpeafqwnrriefedggvinmssditykdkvlhgdvwa
    lgvnfppngpvmkneivmeepaeetltakngvlvgfcpkayllkdgsyyyghmttfyrsk
    ksgqplpgfhfikhrlvktkvepgfkmveqaeyatahvcdlpkpn
    

    Sequence, based on observed residues (ATOM records): (download)
    >2c9jG (G:)
    dnnlsvsvymkgnvnnhefeydgigggdpnsgqfslktklrggkplpfsydiitmgfqyg
    fraftkypegiadyfkgsfpeafqwnrriefedggvinmssditykdkvlhgdvwalgvn
    fppngpvmkneivmeepaeetltakngvlvgfcpkayllkdgsyyyghmttfyrskksgq
    plpgfhfikhrlvktkvepgfkmveqaeyatahvcdlpkp
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >2c9jH (H:)
    msqldnnlsvsvymkgnvnnhefeydgigggdpnsgqfslktklrggkplpfsydiitmg
    fqygfraftkypegiadyfkgsfpeafqwnrriefedggvinmssditykdkvlhgdvwa
    lgvnfppngpvmkneivmeepaeetltakngvlvgfcpkayllkdgsyyyghmttfyrsk
    ksgqplpgfhfikhrlvktkvepgfkmveqaeyatahvcdlpkpn
    

    Sequence, based on observed residues (ATOM records): (download)
    >2c9jH (H:)
    ldnnlsvsvymkgnvnnhefeydgigggdpnsgqfslktklrggkplpfsydiitmgfqy
    gfraftkypegiadyfkgsfpeafqwnrriefedggvinmssditykdkvlhgdvwalgv
    nfppngpvmkneivmeepaeetltakngvlvgfcpkayllkdgsyyyghmttfyrskksg
    qplpgfhfikhrlvktkvepgfkmveqaeyatahvcdlpkp