PDB entry 2c9a

View 2c9a on RCSB PDB site
Description: crystal structure of the mam-ig module of receptor protein tyrosine phosphatase mu
Class: hydrolase
Keywords: glycoprotein, hydrolase, immunoglobulin domain, receptor
Deposited on 2005-12-09, released 2006-01-19
The last revision prior to the SCOPe 2.06 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-31.
Experiment type: XRAY
Resolution: 2.7 Å
R-factor: 0.225
AEROSPACI score: 0.24 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: receptor-type tyrosine-protein phosphatase mu
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P28827 (0-258)
      • conflict see remark 9 (47)
    Domains in SCOPe 2.06: d2c9aa1, d2c9aa2
  • Heterogens: NAG, NA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >2c9aA (A:)
etfsggclfdepystcgysqsegddfnweqvntltkptsdpwmpsgsfmlvnasgrpegq
rahlllpqlkendthcidfhyfvssksnsppgllnvyvkvnngplgnpiwnisgdptrtw
nraelaistfwpnfyqvifevitsghqgylaidevkvlghpctrtphflriqnvevnagq
fatfqcsaigrtvagdrlwlqgidvrdaplkeikvtssrrfiasfnvvnttkrdagkyrc
mirteggvgisnyaelvvk