PDB entry 2c8v

View 2c8v on RCSB PDB site
Description: Insights into the role of nucleotide-dependent conformational change in nitrogenase catalysis: Structural characterization of the nitrogenase Fe protein Leu127 deletion variant with bound MgATP
Class: oxidoreductase
Keywords: oxidoreductase, nitrogenase, nitrogen fixation, mgadp, fe protein, av2, 4fe- 4s, ATP-binding, iron, iron-sulfur, metal-binding, nucleotide-binding
Deposited on 2005-12-08, released 2006-06-01
The last revision prior to the SCOPe 2.06 freeze date was dated 2013-03-27, with a file datestamp of 2013-03-22.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.2381
AEROSPACI score: 0.26 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: nitrogenase iron protein 1
    Species: Azotobacter vinelandii [TaxId:354]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2c8va_
  • Heterogens: FES, MG, ATP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2c8vA (A:)
    amrqcaiygkggigkstttqnlvaalaemgkkvmivgcdpkadstrlilhskaqntimem
    aaeagtvedleledvlkagyggvkcvesggpepgvgcagrgvitainfleeegayeddld
    fvfydvgdvvcggfampirenkaqeiyivcsgemmamyaanniskgivkyansgsvrlgg
    licnsrntdredeliialanklgtqmihfvprdnvvqraeirrmtvieydpkakqadeyr
    alarkvvdnkllvipnpitmdeleellmefgimevedesivgktaeev
    

    Sequence, based on observed residues (ATOM records): (download)
    >2c8vA (A:)
    amrqcaiygkggigkstttqnlvaalaemgkkvmivgcdpkadstrlilhskaqntimem
    aaeagtvedleledvlkagyggvkcvesggpepgvgcagrgvitainfleeegayeddld
    fvfydvgdvvcggfampirenkaqeiyivcsgemmamyaanniskgivkyansgsvrlgg
    licnsrntdredeliialanklgtqmihfvprdnvvqraeirrmtvieydpkakqadeyr
    alarkvvdnkllvipnpitmdeleellmefgi