PDB entry 2c8j

View 2c8j on RCSB PDB site
Description: crystal structure of ferrochelatase hemh-1 from bacillus anthracis, str. ames
Class: lyase
Keywords: ferrochelatase, iron metabolism, heme biosynthesis, lyase, metal-binding, porphyrin biosynthesis
Deposited on 2005-12-05, released 2007-05-01
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-31.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.237
AEROSPACI score: 0.36 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: ferrochelatase 1
    Species: BACILLUS ANTHRACIS [TaxId:198094]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2c8ja_
  • Chain 'B':
    Compound: ferrochelatase 1
    Species: BACILLUS ANTHRACIS [TaxId:198094]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2c8jb_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2c8jA (A:)
    mkkkigllvmaygtpykeedieryythirrgrkpspemledlteryraiggisplatitl
    eqakklekrlnevqdeveyhmylglkhiepfiedavkemhndgiqdaialvlaphystfs
    vksyvgraqeeaeklgnltihgidswykepkfiqywvdavksiysgmsdaerekavlivs
    ahslpekiiamgdpypdqlnetadyiargaevanyavgwqsagntpdpwigpdvqdltre
    lnekygytsfvyapvgfvaehlevlydndfeckvvtdeigakyyrpempnasdafidclt
    dvvvkkkesvm
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2c8jB (B:)
    mkkkigllvmaygtpykeedieryythirrgrkpspemledlteryraiggisplatitl
    eqakklekrlnevqdeveyhmylglkhiepfiedavkemhndgiqdaialvlaphystfs
    vksyvgraqeeaeklgnltihgidswykepkfiqywvdavksiysgmsdaerekavlivs
    ahslpekiiamgdpypdqlnetadyiargaevanyavgwqsagntpdpwigpdvqdltre
    lnekygytsfvyapvgfvaehlevlydndfeckvvtdeigakyyrpempnasdafidclt
    dvvvkkkesvm
    

    Sequence, based on observed residues (ATOM records): (download)
    >2c8jB (B:)
    kkkigllvmaygtpykeedieryythirrgrkpspemledlteryraiggisplatitle
    qakklekrlnevqdeveyhmylglkhiepfiedavkemhndgiqdaialvlaphystfsv
    ksyvgraqeeaeklgnltihgidswykepkfiqywvdavksiysgmsdaerekavlivsa
    hslpekiiamgdpypdqlnetadyiargaevanyavgwqsagntpdpwigpdvqdltrel
    nekygytsfvyapvgfvaehlevlydndfeckvvtdeigakyyrpempnasdafidcltd
    vvvkkkesvm