PDB entry 2c8c

View 2c8c on RCSB PDB site
Description: structure of the artt motif q212a mutant c3bot1 exoenzyme (nad-bound state, crystal form I)
Class: transferase
Keywords: c3 exoenzyme, artt motif, bacterial toxins, glycosyltransferase, transferase
Deposited on 2005-12-03, released 2007-02-27
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-06-08, with a file datestamp of 2011-06-03.
Experiment type: XRAY
Resolution: 2.7 Å
R-factor: 0.243
AEROSPACI score: 0.25 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Mono-ADP-ribosyltransferase C3
    Species: Clostridium botulinum [TaxId:1491]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • Uniprot P15879
      • engineered mutation (171)
    Domains in SCOPe 2.07: d2c8ca_
  • Chain 'B':
    Compound: Mono-ADP-ribosyltransferase C3
    Species: Clostridium botulinum [TaxId:1491]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • Uniprot P15879
      • engineered mutation (171)
    Domains in SCOPe 2.07: d2c8cb_
  • Chain 'C':
    Compound: Mono-ADP-ribosyltransferase C3
    Species: Clostridium botulinum [TaxId:1491]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • Uniprot P15879 (Start-210)
      • engineered mutation (171)
    Domains in SCOPe 2.07: d2c8cc_
  • Chain 'D':
    Compound: Mono-ADP-ribosyltransferase C3
    Species: Clostridium botulinum [TaxId:1491]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • Uniprot P15879
      • engineered mutation (171)
    Domains in SCOPe 2.07: d2c8cd_
  • Heterogens: NAD, ADP

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2c8cA (A:)
    aysntyqeftnidqakawgnaqykkyglsksekeaivsytksaseingklrqnkgvingf
    psnlikqvelldksfnkmktpenimlfrgddpaylgtefqntllnsngtinktafekaka
    kflnkdrleygyistslmnvsqfagrpiitkfkvakgskagyidpisafagalemllprh
    styhiddmrlssdgkqiiitatmmgtainpk
    

    Sequence, based on observed residues (ATOM records): (download)
    >2c8cA (A:)
    ntyqeftnidqakawgnaqykkyglsksekeaivsytksaseingklrqnkgvingfpsn
    likqvelldksfnkmktpenimlfrgddpaylgtefqntllnsngtinktafekakakfl
    nkdrleygyistslmnvsqfagrpiitkfkvakgskagyidpisafagalemllprhsty
    hiddmrlssdgkqiiitatmmgtai
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2c8cB (B:)
    aysntyqeftnidqakawgnaqykkyglsksekeaivsytksaseingklrqnkgvingf
    psnlikqvelldksfnkmktpenimlfrgddpaylgtefqntllnsngtinktafekaka
    kflnkdrleygyistslmnvsqfagrpiitkfkvakgskagyidpisafagalemllprh
    styhiddmrlssdgkqiiitatmmgtainpk
    

    Sequence, based on observed residues (ATOM records): (download)
    >2c8cB (B:)
    sntyqeftnidqakawgnaqykkyglsksekeaivsytksaseingklrqnkgvingfps
    nlikqvelldksfnkmktpenimlfrgddpaylgtefqntllnsngtinktafekakakf
    lnkdrleygyistslmnvsqfagrpiitkfkvakgskagyidpisafagalemllprhst
    yhiddmrlssdgkqiiitatmmgta
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >2c8cC (C:)
    aysntyqeftnidqakawgnaqykkyglsksekeaivsytksaseingklrqnkgvingf
    psnlikqvelldksfnkmktpenimlfrgddpaylgtefqntllnsngtinktafekaka
    kflnkdrleygyistslmnvsqfagrpiitkfkvakgskagyidpisafagalemllprh
    styhiddmrlssdgkqiiitatmmgtainpk
    

    Sequence, based on observed residues (ATOM records): (download)
    >2c8cC (C:)
    ntyqeftnidqakawgnaqykkyglsksekeaivsytksaseingklrqnkgvingfpsn
    likqvelldksfnkmktpenimlfrgddpaylgtefqntllnsngtinktafekakakfl
    nkdrleygyistslmnvsqfagrpiitkfkvakgskagyidpisafagalemllprhsty
    hiddmrlssdgkqiiitatmmgtainpk
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >2c8cD (D:)
    aysntyqeftnidqakawgnaqykkyglsksekeaivsytksaseingklrqnkgvingf
    psnlikqvelldksfnkmktpenimlfrgddpaylgtefqntllnsngtinktafekaka
    kflnkdrleygyistslmnvsqfagrpiitkfkvakgskagyidpisafagalemllprh
    styhiddmrlssdgkqiiitatmmgtainpk
    

    Sequence, based on observed residues (ATOM records): (download)
    >2c8cD (D:)
    ntyqeftnidqakawgnaqykkyglsksekeaivsytksaseingklrqnkgvingfpsn
    likqvelldksfnkmktpenimlfrgddpaylgtefqntllnsngtinktafekakakfl
    nkdrleygyistslmnvsqfagrpiitkfkvakgskagyidpisafagalemllprhsty
    hiddmrlssdgkqiiitatmmgta