PDB entry 2c8b

View 2c8b on RCSB PDB site
Description: structure of the artt motif q212a mutant c3bot1 exoenzyme (free state, crystal form II)
Class: transferase
Keywords: c3 exoenzyme, artt motif, bacterial toxins, transferase, glycosyltransferase
Deposited on 2005-12-03, released 2007-02-27
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-06-08, with a file datestamp of 2011-06-03.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: 0.192
AEROSPACI score: 0.55 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'X':
    Compound: Mono-ADP-ribosyltransferase C3
    Species: CLOSTRIDIUM BOTULINUM D BACTERIOPHAGE [TaxId:29342]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • Uniprot P15879
      • engineered mutation (171)
    Domains in SCOPe 2.07: d2c8bx_
  • Heterogens: SO4, HOH

PDB Chain Sequences:

  • Chain 'X':
    Sequence, based on SEQRES records: (download)
    >2c8bX (X:)
    aysntyqeftnidqakawgnaqykkyglsksekeaivsytksaseingklrqnkgvingf
    psnlikqvelldksfnkmktpenimlfrgddpaylgtefqntllnsngtinktafekaka
    kflnkdrleygyistslmnvsqfagrpiitkfkvakgskagyidpisafagalemllprh
    styhiddmrlssdgkqiiitatmmgtainpk
    

    Sequence, based on observed residues (ATOM records): (download)
    >2c8bX (X:)
    tyqeftnidqakawgnaqykkyglsksekeaivsytksaseingklrqnkgvingfpsnl
    ikqvelldksfnkmktpenimlfrgddpaylgtefqntllnsngtinktafekakakfln
    kdrleygyistslmnvsqfagrpiitkfkvakgskagyidpisafagalemllprhstyh
    iddmrlssdgkqiiitatmmg