PDB entry 2c8a

View 2c8a on RCSB PDB site
Description: structure of the wild-type c3bot1 exoenzyme (nicotinamide-bound state, crystal form I)
Class: transferase
Keywords: c3 exoenzyme, artt motif, ADP-ribosyltransferase, bacterial toxins, nicotinamide, transferase, glycosyltransferase
Deposited on 2005-12-03, released 2007-02-27
The last revision prior to the SCOP 1.73 freeze date was dated 2007-02-27, with a file datestamp of 2007-06-28.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: 0.207
AEROSPACI score: 0.52 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Mono-ADP-ribosyltransferase C3
    Species: Clostridium botulinum
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d2c8aa1
  • Chain 'B':
    Compound: Mono-ADP-ribosyltransferase C3
    Species: Clostridium botulinum
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d2c8ab1
  • Chain 'C':
    Compound: Mono-ADP-ribosyltransferase C3
    Species: Clostridium botulinum
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d2c8ac1
  • Chain 'D':
    Compound: Mono-ADP-ribosyltransferase C3
    Species: Clostridium botulinum
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d2c8ad1
  • Heterogens: SO4, NCA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2c8aA (A:)
    aysntyqeftnidqakawgnaqykkyglsksekeaivsytksaseingklrqnkgvingf
    psnlikqvelldksfnkmktpenimlfrgddpaylgtefqntllnsngtinktafekaka
    kflnkdrleygyistslmnvsqfagrpiitkfkvakgskagyidpisafagqlemllprh
    styhiddmrlssdgkqiiitatmmgtainpk
    

    Sequence, based on observed residues (ATOM records): (download)
    >2c8aA (A:)
    ntyqeftnidqakawgnaqykkyglsksekeaivsytksaseingklrqnkgvingfpsn
    likqvelldksfnkmktpenimlfrgddpaylgtefqntllnsngtinktafekakakfl
    nkdrleygyistslmnvsqfagrpiitkfkvakgskagyidpisafagqlemllprhsty
    hiddmrlssdgkqiiitatmmgtainpk
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2c8aB (B:)
    aysntyqeftnidqakawgnaqykkyglsksekeaivsytksaseingklrqnkgvingf
    psnlikqvelldksfnkmktpenimlfrgddpaylgtefqntllnsngtinktafekaka
    kflnkdrleygyistslmnvsqfagrpiitkfkvakgskagyidpisafagqlemllprh
    styhiddmrlssdgkqiiitatmmgtainpk
    

    Sequence, based on observed residues (ATOM records): (download)
    >2c8aB (B:)
    ntyqeftnidqakawgnaqykkyglsksekeaivsytksaseingklrqnkgvingfpsn
    likqvelldksfnkmktpenimlfrgddpaylgtefqntllnsngtinktafekakakfl
    nkdrleygyistslmnvsqfagrpiitkfkvakgskagyidpisafagqlemllprhsty
    hiddmrlssdgkqiiitatmmg
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >2c8aC (C:)
    aysntyqeftnidqakawgnaqykkyglsksekeaivsytksaseingklrqnkgvingf
    psnlikqvelldksfnkmktpenimlfrgddpaylgtefqntllnsngtinktafekaka
    kflnkdrleygyistslmnvsqfagrpiitkfkvakgskagyidpisafagqlemllprh
    styhiddmrlssdgkqiiitatmmgtainpk
    

    Sequence, based on observed residues (ATOM records): (download)
    >2c8aC (C:)
    tyqeftnidqakawgnaqykkyglsksekeaivsytksaseingklrqnkgvingfpsnl
    ikqvelldksfnkmktpenimlfrgddpaylgtefqntllnsngtinktafekakakfln
    kdrleygyistslmnvsqfagrpiitkfkvakgskagyidpisafagqlemllprhstyh
    iddmrlssdgkqiiitatmmgtainpk
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >2c8aD (D:)
    aysntyqeftnidqakawgnaqykkyglsksekeaivsytksaseingklrqnkgvingf
    psnlikqvelldksfnkmktpenimlfrgddpaylgtefqntllnsngtinktafekaka
    kflnkdrleygyistslmnvsqfagrpiitkfkvakgskagyidpisafagqlemllprh
    styhiddmrlssdgkqiiitatmmgtainpk
    

    Sequence, based on observed residues (ATOM records): (download)
    >2c8aD (D:)
    tyqeftnidqakawgnaqykkyglsksekeaivsytksaseingklrqnkgvingfpsnl
    ikqvelldksfnkmktpenimlfrgddpaylgtefqntllnsngtinktafekakakfln
    kdrleygyistslmnvsqfagrpiitkfkvakgskagyidpisafagqlemllprhstyh
    iddmrlssdgkqiiitatmmgt