PDB entry 2c89

View 2c89 on RCSB PDB site
Description: structure of the wild-type c3bot1 exoenzyme (free state, crystal form I)
Class: transferase
Keywords: c3 exoenzyme, artt motif, bacterial toxins, transferase, glycosyltransferase
Deposited on 2005-12-03, released 2007-02-27
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-06-08, with a file datestamp of 2011-06-03.
Experiment type: XRAY
Resolution: 1.85 Å
R-factor: 0.21
AEROSPACI score: 0.48 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Mono-ADP-ribosyltransferase C3
    Species: Clostridium botulinum [TaxId:1491]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2c89a_
  • Chain 'B':
    Compound: Mono-ADP-ribosyltransferase C3
    Species: Clostridium botulinum [TaxId:1491]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2c89b_
  • Chain 'C':
    Compound: Mono-ADP-ribosyltransferase C3
    Species: Clostridium botulinum [TaxId:1491]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2c89c_
  • Chain 'D':
    Compound: Mono-ADP-ribosyltransferase C3
    Species: Clostridium botulinum [TaxId:1491]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2c89d_
  • Heterogens: SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2c89A (A:)
    aysntyqeftnidqakawgnaqykkyglsksekeaivsytksaseingklrqnkgvingf
    psnlikqvelldksfnkmktpenimlfrgddpaylgtefqntllnsngtinktafekaka
    kflnkdrleygyistslmnvsqfagrpiitkfkvakgskagyidpisafagqlemllprh
    styhiddmrlssdgkqiiitatmmgtainpk
    

    Sequence, based on observed residues (ATOM records): (download)
    >2c89A (A:)
    ntyqeftnidqakawgnaqykkyglsksekeaivsytksaseingklrqnkgvingfpsn
    likqvelldksfnkmktpenimlfrgddpaylgtefqntllnsngtinktafekakakfl
    nkdrleygyistslmnvsqfagrpiitkfkvakgskagyidpisafagqlemllprhsty
    hiddmrlssdgkqiiitatmm
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2c89B (B:)
    aysntyqeftnidqakawgnaqykkyglsksekeaivsytksaseingklrqnkgvingf
    psnlikqvelldksfnkmktpenimlfrgddpaylgtefqntllnsngtinktafekaka
    kflnkdrleygyistslmnvsqfagrpiitkfkvakgskagyidpisafagqlemllprh
    styhiddmrlssdgkqiiitatmmgtainpk
    

    Sequence, based on observed residues (ATOM records): (download)
    >2c89B (B:)
    tyqeftnidqakawgnaqykkyglsksekeaivsytksaseingklrqnkgvingfpsnl
    ikqvelldksfnkmktpenimlfrgddpaylgtefqntllnsngtinktafekakakfln
    kdrleygyistslmnvsqfagrpiitkfkvakgskagyidpisafagqlemllprhstyh
    iddmrlssdgkqiiitatmmgt
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >2c89C (C:)
    aysntyqeftnidqakawgnaqykkyglsksekeaivsytksaseingklrqnkgvingf
    psnlikqvelldksfnkmktpenimlfrgddpaylgtefqntllnsngtinktafekaka
    kflnkdrleygyistslmnvsqfagrpiitkfkvakgskagyidpisafagqlemllprh
    styhiddmrlssdgkqiiitatmmgtainpk
    

    Sequence, based on observed residues (ATOM records): (download)
    >2c89C (C:)
    tyqeftnidqakawgnaqykkyglsksekeaivsytksaseingklrqnkgvingfpsnl
    ikqvelldksfnkmktpenimlfrgddpaylgtefqntllnsngtinktafekakakfln
    kdrleygyistslmnvsqfagrpiitkfkvakgskagyidpisafagqlemllprhstyh
    iddmrlssdgkqiiitatmmgtainpk
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >2c89D (D:)
    aysntyqeftnidqakawgnaqykkyglsksekeaivsytksaseingklrqnkgvingf
    psnlikqvelldksfnkmktpenimlfrgddpaylgtefqntllnsngtinktafekaka
    kflnkdrleygyistslmnvsqfagrpiitkfkvakgskagyidpisafagqlemllprh
    styhiddmrlssdgkqiiitatmmgtainpk
    

    Sequence, based on observed residues (ATOM records): (download)
    >2c89D (D:)
    tyqeftnidqakawgnaqykkyglsksekeaivsytksaseingklrqnkgvingfpsnl
    ikqvelldksfnkmktpenimlfrgddpaylgtefqntllnsngtinktafekakakfln
    kdrleygyistslmnvsqfagrpiitkfkvakgskagyidpisafagqlemllprhstyh
    iddmrlssdgkqiiitatmm