PDB entry 2c80

View 2c80 on RCSB PDB site
Description: Structure of Sh28GST in complex with S-hexyl Glutathione
Class: transferase
Keywords: sigma class gst, detoxification, glutathione, prostaglandin d2 synthase, inhibitor, transferase, antigen
Deposited on 2005-11-30, released 2006-06-21
The last revision prior to the SCOPe 2.06 freeze date was dated 2013-05-08, with a file datestamp of 2013-05-03.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.191
AEROSPACI score: 0.37 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: glutathione s-transferase 28 kda
    Species: SCHISTOSOMA HAEMATOBIUM [TaxId:6185]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2c80a1, d2c80a2
  • Chain 'B':
    Compound: glutathione s-transferase 28 kda
    Species: SCHISTOSOMA HAEMATOBIUM [TaxId:6185]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2c80b1, d2c80b2
  • Heterogens: GTX, PG4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2c80A (A:)
    mtgdhikviyfngrgraesirmtlvaagvnyederisfqdwpkikptipggrlpavkitd
    nhghvkwmveslaiarymakkhhmmggteeeyynvekligqaedleheyyktlmkpeeek
    qkiikeilngkvpvlldiiceslkastgklavgdkvtladlvliavidhvtdldkefltg
    kypeihkhrenllassprlakylsdraatpf
    

    Sequence, based on observed residues (ATOM records): (download)
    >2c80A (A:)
    dhikviyfngrgraesirmtlvaagvnyederisfqdwpkikptipggrlpavkitdnhg
    hvkwmveslaiarymakkhhmmggteeeyynvekligqaedleheyyktlmkpeeekqki
    ikeilngkvpvlldiiceslkastgklavgdkvtladlvliavidhvtdldkefltgkyp
    eihkhrenllassprlakylsdraatpf
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2c80B (B:)
    mtgdhikviyfngrgraesirmtlvaagvnyederisfqdwpkikptipggrlpavkitd
    nhghvkwmveslaiarymakkhhmmggteeeyynvekligqaedleheyyktlmkpeeek
    qkiikeilngkvpvlldiiceslkastgklavgdkvtladlvliavidhvtdldkefltg
    kypeihkhrenllassprlakylsdraatpf
    

    Sequence, based on observed residues (ATOM records): (download)
    >2c80B (B:)
    dhikviyfngrgraesirmtlvaagvnyederisfqdwpkikptipggrlpavkitdnhg
    hvkwmveslaiarymakkhhmmggteeeyynvekligqaedleheyyktlmkpeeekqki
    ikeilngkvpvlldiiceslkastgklavgdkvtladlvliavidhvtdldkefltgkyp
    eihkhrenllassprlakylsdraatpf