PDB entry 2c7w

View 2c7w on RCSB PDB site
Description: crystal structure of human vascular endothelial growth factor-b: identification of amino acids important for angiogeninc activity
Class: growth factor
Keywords: vascular endothelial growth factor-b, angiogenesis, cysteine-knot motif, tyrosine kinase, ischemia, mitogen, glycoprotein, growth factor, heparin-binding
Deposited on 2005-11-29, released 2007-01-30
The last revision prior to the SCOPe 2.01 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.48 Å
R-factor: 0.286
AEROSPACI score: 0.21 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: vascular endothelial growth factor b precursor
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d2c7wa_
  • Chain 'B':
    Compound: vascular endothelial growth factor b precursor
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d2c7wb_
  • Heterogens: MPD, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2c7wA (A:)
    hqrkvvswidvytratcqprevvvpltvelmgtvakqlvpscvtvqrcggccpddglecv
    ptgqhqvrmqilmirypssqlgemsleehsqcecrpkkk
    

    Sequence, based on observed residues (ATOM records): (download)
    >2c7wA (A:)
    kvvswidvytratcqprevvvpltvelmgtvakqlvpscvtvqrcggccpddglecvptg
    qhqvrmqilmirypssqlgemsleehsqcecrpkkk
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2c7wB (B:)
    hqrkvvswidvytratcqprevvvpltvelmgtvakqlvpscvtvqrcggccpddglecv
    ptgqhqvrmqilmirypssqlgemsleehsqcecrpkkk
    

    Sequence, based on observed residues (ATOM records): (download)
    >2c7wB (B:)
    kvvswidvytratcqprevvvpltvelmgtvakqlvpscvtvqrcggccpddglecvptg
    qhqvrmqilmirypssqlgemsleehsqcecrpkkk