PDB entry 2c7v

View 2c7v on RCSB PDB site
Description: structure of trypanosoma brucei pteridine reductase (ptr1) in ternary complex with cofactor and the antifolate methotrexate
Class: oxidoreductase
Keywords: pteridine reductase, trypanosomatids, drug resistance, short-chain dehydrogenase/reductase, methotrexate resistance, oxidoreductase
Deposited on 2005-11-29, released 2006-09-19
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.157
AEROSPACI score: 0.42 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: pteridine reductase
    Species: Trypanosoma brucei brucei [TaxId:5702]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2c7va_
  • Chain 'B':
    Compound: pteridine reductase
    Species: Trypanosoma brucei brucei [TaxId:5702]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2c7vb_
  • Chain 'C':
    Compound: pteridine reductase
    Species: Trypanosoma brucei brucei [TaxId:5702]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2c7vc_
  • Chain 'D':
    Compound: pteridine reductase
    Species: Trypanosoma brucei brucei [TaxId:5702]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2c7vd_
  • Heterogens: NAP, MTX, NI, ACT, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2c7vA (A:)
    meapaavvtgaakrigraiavklhqtgyrvvihyhnsaeaavsladelnkersntavvcq
    adltnsnvlpasceeiinscfrafgrcdvlvnnasafyptplvqgdhednsngktvetqv
    aeligtnaiapflltmsfaqrqkgtnpnctssnlsivnlcdamvdqpcmafslynmgkha
    lvgltqsaalelapygirvngvapgvsllpvamgeeekdkwrrkvplgrreasaeqiada
    viflvsgsaqyitgsiikvdgglslvha
    

    Sequence, based on observed residues (ATOM records): (download)
    >2c7vA (A:)
    eapaavvtgaakrigraiavklhqtgyrvvihyhnsaeaavsladelnkersntavvcqa
    dltnsnvlpasceeiinscfrafgrcdvlvnnasafyptplvqgktvetqvaeligtnai
    apflltmsfaqrqkgssnlsivnlcdamvdqpcmafslynmgkhalvgltqsaalelapy
    girvngvapgvsllpvamgeeekdkwrrkvplgrreasaeqiadaviflvsgsaqyitgs
    iikvdgglslvha
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2c7vB (B:)
    meapaavvtgaakrigraiavklhqtgyrvvihyhnsaeaavsladelnkersntavvcq
    adltnsnvlpasceeiinscfrafgrcdvlvnnasafyptplvqgdhednsngktvetqv
    aeligtnaiapflltmsfaqrqkgtnpnctssnlsivnlcdamvdqpcmafslynmgkha
    lvgltqsaalelapygirvngvapgvsllpvamgeeekdkwrrkvplgrreasaeqiada
    viflvsgsaqyitgsiikvdgglslvha
    

    Sequence, based on observed residues (ATOM records): (download)
    >2c7vB (B:)
    eapaavvtgaakrigraiavklhqtgyrvvihyhnsaeaavsladelnkersntavvcqa
    dltnsnvlpasceeiinscfrafgrcdvlvnnasafyptplvqngktvetqvaeligtna
    iapflltmsfaqrqktssnlsivnlcdamvdqpcmafslynmgkhalvgltqsaalelap
    ygirvngvapgvsllpvamgeeekdkwrrkvplgrreasaeqiadaviflvsgsaqyitg
    siikvdgglslvha
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >2c7vC (C:)
    meapaavvtgaakrigraiavklhqtgyrvvihyhnsaeaavsladelnkersntavvcq
    adltnsnvlpasceeiinscfrafgrcdvlvnnasafyptplvqgdhednsngktvetqv
    aeligtnaiapflltmsfaqrqkgtnpnctssnlsivnlcdamvdqpcmafslynmgkha
    lvgltqsaalelapygirvngvapgvsllpvamgeeekdkwrrkvplgrreasaeqiada
    viflvsgsaqyitgsiikvdgglslvha
    

    Sequence, based on observed residues (ATOM records): (download)
    >2c7vC (C:)
    eapaavvtgaakrigraiavklhqtgyrvvihyhnsaeaavsladelnkersntavvcqa
    dltnsnvlpasceeiinscfrafgrcdvlvnnasafyptplvqggktvetqvaeligtna
    iapflltmsfaqrqkgtnpnctssnlsivnlcdamvdqpcmafslynmgkhalvgltqsa
    alelapygirvngvapgvsllpvamgeeekdkwrrkvplgrreasaeqiadaviflvsgs
    aqyitgsiikvdgglslvha
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >2c7vD (D:)
    meapaavvtgaakrigraiavklhqtgyrvvihyhnsaeaavsladelnkersntavvcq
    adltnsnvlpasceeiinscfrafgrcdvlvnnasafyptplvqgdhednsngktvetqv
    aeligtnaiapflltmsfaqrqkgtnpnctssnlsivnlcdamvdqpcmafslynmgkha
    lvgltqsaalelapygirvngvapgvsllpvamgeeekdkwrrkvplgrreasaeqiada
    viflvsgsaqyitgsiikvdgglslvha
    

    Sequence, based on observed residues (ATOM records): (download)
    >2c7vD (D:)
    eapaavvtgaakrigraiavklhqtgyrvvihyhnsaeaavsladelnkersntavvcqa
    dltnsnvlpasceeiinscfrafgrcdvlvnnasafyptplvqgdhngktvetqvaelig
    tnaiapflltmsfaqrqkgssnlsivnlcdamvdqpcmafslynmgkhalvgltqsaale
    lapygirvngvapgvsllpvamgeeekdkwrrkvplgrreasaeqiadaviflvsgsaqy
    itgsiikvdgglslvha