PDB entry 2c7t

View 2c7t on RCSB PDB site
Description: crystal structure of the plp-bound form of btrr, a dual functional aminotransferase involved in butirosin biosynthesis.
Class: transferase
Keywords: aminotransferase, smat, butirosin, aminoglycoside antibiotics, transferase
Deposited on 2005-11-29, released 2006-08-16
The last revision prior to the SCOPe 2.05 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.174
AEROSPACI score: 0.44 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: glutamine-2-deoxy-scyllo-inosose aminotransferase
    Species: Bacillus circulans [TaxId:1397]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d2c7ta_
  • Heterogens: PLP, SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2c7tA (A:)
    mtipfdhwpewpqhsdrtrrkieevfqsnrwaisgywtgeesmerkfakafadfngvpyc
    vpttsgstalmlalealgigegdevivpsltwiatatavlnvnalpvfvdveadtycidp
    qliksaitdktkaiipvhlfgsmanmdeineiaqehnlfviedcaqshgsvwnnqragti
    gdigafscqqgkvltageggiivtknprlfeliqqlradsrvycddsselmhgdmqlvkk
    gdiqgsnyclsefqsailldqlqelddknaireknamflndalskidgikvmkrppqvsr
    qtyygyvfrfdpvkfgglnadqfceilreklnmgtfylhppylpvhknplfcpwtknryl
    ksvrkteaywrglhypvserasgqsivihhaillaepshlsllvdavaelarkfcvth
    

    Sequence, based on observed residues (ATOM records): (download)
    >2c7tA (A:)
    dhwpewpqhsdrtrrkieevfqsnrwaisgywtgeesmerkfakafadfngvpycvptts
    gstalmlalealgigegdevivpsltwiatatavlnvnalpvfvdveadtycidpqliks
    aitdktkaiipvhlfgsmanmdeineiaqehnlfviedcaqshgsvwnnqragtigdiga
    fscqqgkvltageggiivtknprlfeliqqlradsrvycddsselmhgdmqlvkkgdiqg
    snyclsefqsailldqlqelddknaireknamflndalskidgikvmkrppqvsrqtyyg
    yvfrfdpvkfgglnadqfceilreklnmgtfylhppylpvhknplfcpwtknrylksvrk
    teaywrglhypvserasgqsivihhaillaepshlsllvdavaelarkfcvt