PDB entry 2c7q

View 2c7q on RCSB PDB site
Description: HhaI DNA methyltransferase complex with oligonucleotide containing 2- aminopurine outside the recognition sequence (paired with G) and SAH
Class: transferase/DNA
Keywords: base flipping, restriction system, transferase-DNA complex
Deposited on 2005-11-27, released 2005-12-14
The last revision prior to the SCOPe 2.08 freeze date was dated 2019-07-24, with a file datestamp of 2019-07-19.
Experiment type: XRAY
Resolution: 1.85 Å
R-factor: N/A
AEROSPACI score: 0.35 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: modification methylase hhai
    Species: Haemophilus haemolyticus [TaxId:726]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d2c7qa_
  • Chain 'C':
    Compound: 5'-d(*t*gp*gp*(2pr)*gp*gp*(5cm)*gp*cp*tp*gp* ap*c)-3'
    Species: synthetic construct, synthetic [TaxId:32630]
  • Chain 'D':
    Compound: 5'-d(*t*gp*tp*cp*ap*gp*cp*gp*cp*cp*gp*cp*c)-3'
    Species: synthetic construct, synthetic [TaxId:32630]
  • Heterogens: SAH, SO4, CIT, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >2c7qA (A:)
mieikdkqltglrfidlfaglggfrlalescgaecvysnewdkyaqevyemnfgekpegd
itqvnektipdhdilcagfpcqafsisgkqkgfedsrgtlffdiarivrekkpkvvfmen
vknfashdngntlevvkntmneldysfhakvlnaldygipqkreriymicfrndlniqnf
qfpkpfelntfvkdlllpdsevehlvidrkdlvmtnqeieqttpktvrlgivgkggqger
iystrgiaitlsaygggifaktggylvngktrklhprecarvmgypdsykvhpstsqayk
qfgnsvvinvlqyiaynigsslnfkpy

  • Chain 'C':
    No sequence available.

  • Chain 'D':
    No sequence available.