PDB entry 2c7o

View 2c7o on RCSB PDB site
Description: HhaI DNA methyltransferase complex with 13mer oligonucleotide containing 2-aminopurine adjacent to the target base (PCGC:GMGC) and SAH
Class: transferase/DNA
Keywords: transferase-DNA complex, base flipping, transferase restriction system
Deposited on 2005-11-25, released 2005-12-14
The last revision prior to the SCOPe 2.08 freeze date was dated 2019-07-24, with a file datestamp of 2019-07-19.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: N/A
AEROSPACI score: 0.34 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: modification methylase hhai
    Species: Haemophilus haemolyticus [TaxId:726]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d2c7oa_
  • Chain 'C':
    Compound: 5'-d(*t*gp*gp*ap*tp*gp*(5cm)*gp*cp*tp*gp*ap *c)-3'
    Species: synthetic construct, synthetic [TaxId:32630]
  • Chain 'D':
    Compound: 5'-d(*t*gp*tp*cp*ap*(2pr)*cp*gp*cp*ap*tp*cp *c)-3'
    Species: synthetic construct, synthetic [TaxId:32630]
  • Heterogens: SAH, SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2c7oA (A:)
    mieikdkqltglrfidlfaglggfrlalescgaecvysnewdkyaqevyemnfgekpegd
    itqvnektipdhdilcagfpcqafsisgkqkgfedsrgtlffdiarivrekkpkvvfmen
    vknfashdngntlevvkntmneldysfhakvlnaldygipqkreriymicfrndlniqnf
    qfpkpfelntfvkdlllpdsevehlvidrkdlvmtnqeieqttpktvrlgivgkggqger
    iystrgiaitlsaygggifaktggylvngktrklhprecarvmgypdsykvhpstsqayk
    qfgnsvvinvlqyiaynigsslnfkpy
    

  • Chain 'C':
    No sequence available.

  • Chain 'D':
    No sequence available.