PDB entry 2c7j

View 2c7j on RCSB PDB site
Description: phycoerythrocyanin from mastigocladus laminosus, 295 k, 3.0 a
Class: electron transport
Keywords: phycoerythrocyanin, phycoviolobilin, phycocyanobilin, bile pigment, chromophore, electron transport, photosynthesis, phycobilisome
Deposited on 2005-11-24, released 2006-01-25
The last revision prior to the SCOPe 2.04 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 3 Å
R-factor: 0.1894
AEROSPACI score: 0.25 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: phycoerythrocyanin alpha chain
    Species: MASTIGOCLADUS LAMINOSUS [TaxId:83541]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d2c7ja_
  • Chain 'B':
    Compound: phycoerythrocyanin beta chain
    Species: MASTIGOCLADUS LAMINOSUS [TaxId:83541]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d2c7jb_
  • Heterogens: BLA, CYC, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2c7jA (A:)
    mktplteaiaaadlrgsylsntelqavfgrfnraragleaarafanngkkwaeaaanhvy
    qkfpyttqmqgpqyastpegkakcvrdidhylrtisyccvvggtgplddyvvaglkefns
    alglspswyiaalefvrdnhgltgdvageantyinyainals
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2c7jB (B:)
    mldafsrvveqadkkgaylsndeinalqaivadsnkrldvvnrltsnassivanayralv
    aerpqvfnpggpcfhhrnqaacirdlgfilryvtysvlagdtsvmddrclnglretyqal
    gtpgdavasgikkmkeaalkiandpngitkgdcsqlmselasyfdraaaava