PDB entry 2c7b

View 2c7b on RCSB PDB site
Description: the crystal structure of este1, a new thermophilic and thermostable carboxylesterase cloned from a metagenomic library
Class: hydrolase
Keywords: carboxyesterase, thermophilic enzyme, hydrolase, hsl, alpha/beta hydrolase fold
Deposited on 2005-11-21, released 2005-12-01
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.2338
AEROSPACI score: 0.31 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: carboxylesterase
    Species: UNCULTURED ARCHAEON [TaxId:115547]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2c7ba_
  • Chain 'B':
    Compound: carboxylesterase
    Species: UNCULTURED ARCHAEON [TaxId:115547]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2c7bb_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2c7bA (A:)
    mpldpqikpileriralsiaaspqelrrqveeqsrlltaavqepiaetrdvhipvsggsi
    rarvyfpkkaaglpavlyyhgggfvfgsiethdhicrrlsrlsdsvvvsvdyrlapeykf
    ptavedayaalkwvadradelgvdpdriavagdsaggnlaavvsildrnsgeklvkkqvl
    iypvvnmtgvptaslvefgvaettslpielmvwfgrqylkrpeeaydfkasplladlggl
    ppalvvtaeydplrdegelyaykmkasgsravavrfagmvhgfvsfypfvdagrealdla
    aasirsglqps
    

    Sequence, based on observed residues (ATOM records): (download)
    >2c7bA (A:)
    lsiaaspqelrrqveeqsrlltaavqepiaetrdvhipvsggsirarvyfpkkaaglpav
    lyyhgggfvfgsiethdhicrrlsrlsdsvvvsvdyrlapeykfptavedayaalkwvad
    radelgvdpdriavagdsaggnlaavvsildrnsgeklvkkqvliypvvnmtgvptaslv
    efgvaettslpielmvwfgrqylkrpeeaydfkasplladlgglppalvvtaeydplrde
    gelyaykmkasgsravavrfagmvhgfvsfypfvdagrealdlaaasirsglqps
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2c7bB (B:)
    mpldpqikpileriralsiaaspqelrrqveeqsrlltaavqepiaetrdvhipvsggsi
    rarvyfpkkaaglpavlyyhgggfvfgsiethdhicrrlsrlsdsvvvsvdyrlapeykf
    ptavedayaalkwvadradelgvdpdriavagdsaggnlaavvsildrnsgeklvkkqvl
    iypvvnmtgvptaslvefgvaettslpielmvwfgrqylkrpeeaydfkasplladlggl
    ppalvvtaeydplrdegelyaykmkasgsravavrfagmvhgfvsfypfvdagrealdla
    aasirsglqps
    

    Sequence, based on observed residues (ATOM records): (download)
    >2c7bB (B:)
    aspqelrrqveeqsrlltaavqepiaetrdvhipvsggsirarvyfpkkaaglpavlyyh
    gggfvfgsiethdhicrrlsrlsdsvvvsvdyrlapeykfptavedayaalkwvadrade
    lgvdpdriavagdsaggnlaavvsildrnsgeklvkkqvliypvvnmtgvptaslvefgv
    aettslpielmvwfgrqylkrpeeaydfkasplladlgglppalvvtaeydplrdegely
    aykmkasgsravavrfagmvhgfvsfypfvdagrealdlaaasirsglqps