PDB entry 2c72

View 2c72 on RCSB PDB site
Description: functional role of the aromatic cage in human monoamine oxidase b: structures and catalytic properties of tyr435 mutant proteins
Class: oxidoreductase
Keywords: oxidoreductase, enantioselectivity, fad, flavin, flavoprotein, human monoamine oxidase, inhibitor binding, mitochondrion, rasagiline, transmembrane, parkinson
Deposited on 2005-11-17, released 2006-04-19
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.201
AEROSPACI score: 0.44 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: amine oxidase (flavin-containing) b
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 2C72
      • engineered mutation (434)
    • Uniprot P27338
    Domains in SCOPe 2.08: d2c72a1, d2c72a2
  • Chain 'B':
    Compound: amine oxidase (flavin-containing) b
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 2C72
      • engineered mutation (434)
    • Uniprot P27338
    Domains in SCOPe 2.08: d2c72b1, d2c72b2
  • Heterogens: FAD, RSA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2c72A (A:)
    msnkcdvvvvgggisgmaaakllhdsglnvvvleardrvggrtytlrnqkvkyvdlggsy
    vgptqnrilrlakelgletykvneverlihhvkgksypfrgpfppvwnpityldhnnfwr
    tmddmgreipsdapwkaplaeewdnmtmkelldklcwtesakqlatlfvnlcvtaethev
    salwflwyvkqcggttriisttnggqerkfvggsgqvserimdllgdrvklerpviyidq
    trenvlvetlnhemyeakyvisaipptlgmkihfnpplpmmrnqmitrvplgsvikcivy
    ykepfwrkkdycgtmiidgeeapvaytlddtkpegnyaaimgfilahkarklarltkeer
    lkklcelyakvlgslealepvhyeeknwceeqysggcyttyfppgiltqygrvlrqpvdr
    iyfagtetathwsghmegaveageraareilhamgkipedeiwqsepesvdvpaqpittt
    flerhlpsvpgllrliglttifsatalgflahkrgllvrv
    

    Sequence, based on observed residues (ATOM records): (download)
    >2c72A (A:)
    nkcdvvvvgggisgmaaakllhdsglnvvvleardrvggrtytlrnqkvkyvdlggsyvg
    ptqnrilrlakelgletykvneverlihhvkgksypfrgpfppvwnpityldhnnfwrtm
    ddmgreipsdapwkaplaeewdnmtmkelldklcwtesakqlatlfvnlcvtaethevsa
    lwflwyvkqcggttriisttnggqerkfvggsgqvserimdllgdrvklerpviyidqtr
    envlvetlnhemyeakyvisaipptlgmkihfnpplpmmrnqmitrvplgsvikcivyyk
    epfwrkkdycgtmiidgeeapvaytlddtkpegnyaaimgfilahkarklarltkeerlk
    klcelyakvlgslealepvhyeeknwceeqysggcyttyfppgiltqygrvlrqpvdriy
    fagtetathwsghmegaveageraareilhamgkipedeiwqsepesvdvpaqpitttfl
    erhlpsvpgllrligltti
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2c72B (B:)
    msnkcdvvvvgggisgmaaakllhdsglnvvvleardrvggrtytlrnqkvkyvdlggsy
    vgptqnrilrlakelgletykvneverlihhvkgksypfrgpfppvwnpityldhnnfwr
    tmddmgreipsdapwkaplaeewdnmtmkelldklcwtesakqlatlfvnlcvtaethev
    salwflwyvkqcggttriisttnggqerkfvggsgqvserimdllgdrvklerpviyidq
    trenvlvetlnhemyeakyvisaipptlgmkihfnpplpmmrnqmitrvplgsvikcivy
    ykepfwrkkdycgtmiidgeeapvaytlddtkpegnyaaimgfilahkarklarltkeer
    lkklcelyakvlgslealepvhyeeknwceeqysggcyttyfppgiltqygrvlrqpvdr
    iyfagtetathwsghmegaveageraareilhamgkipedeiwqsepesvdvpaqpittt
    flerhlpsvpgllrliglttifsatalgflahkrgllvrv
    

    Sequence, based on observed residues (ATOM records): (download)
    >2c72B (B:)
    nkcdvvvvgggisgmaaakllhdsglnvvvleardrvggrtytlrnqkvkyvdlggsyvg
    ptqnrilrlakelgletykvneverlihhvkgksypfrgpfppvwnpityldhnnfwrtm
    ddmgreipsdapwkaplaeewdnmtmkelldklcwtesakqlatlfvnlcvtaethevsa
    lwflwyvkqcggttriisttnggqerkfvggsgqvserimdllgdrvklerpviyidqtr
    envlvetlnhemyeakyvisaipptlgmkihfnpplpmmrnqmitrvplgsvikcivyyk
    epfwrkkdycgtmiidgeeapvaytlddtkpegnyaaimgfilahkarklarltkeerlk
    klcelyakvlgslealepvhyeeknwceeqysggcyttyfppgiltqygrvlrqpvdriy
    fagtetathwsghmegaveageraareilhamgkipedeiwqsepesvdvpaqpitttfl
    erhlpsvpgllrli