PDB entry 2c6y

View 2c6y on RCSB PDB site
Description: crystal structure of interleukin enhancer-binding factor 1 bound to DNA
Class: transcription regulation
Keywords: transcription regulation, DNA-binding domain, forkhead transcription factors, interleukin enhancer binding factor, winged helix, forkhead
Deposited on 2005-11-15, released 2006-04-18
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: 0.233
AEROSPACI score: 0.29 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: forkhead box protein k2
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 2C6Y (13-28)
    • Uniprot Q01167 (13-110)
    Domains in SCOPe 2.08: d2c6ya_
  • Chain 'B':
    Compound: forkhead box protein k2
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 2C6Y (13-28)
    • Uniprot Q01167 (13-End)
    Domains in SCOPe 2.08: d2c6yb_
  • Chain 'C':
    Compound: interleukin 2 promotor
    Species: HOMO SAPIENS, synthetic [TaxId:9606]
  • Chain 'D':
    Compound: interleukin 2 promotor
    Species: HOMO SAPIENS, synthetic [TaxId:9606]
  • Heterogens: MG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2c6yA (A:)
    asmtggqqmgrgsdskppysyaqlivqaitmapdkqltlngiythitknypyyrtadkgw
    qnsirhnlslnryfikvprsqeepgkgsfwridpasesklieqafrkrrpr
    

    Sequence, based on observed residues (ATOM records): (download)
    >2c6yA (A:)
    dskppysyaqlivqaitmapdkqltlngiythitknypyyrtadkgwqnsirhnlslnry
    fikvprsqeepgkgsfwridpasesklieqafrkrrpr
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2c6yB (B:)
    asmtggqqmgrgsdskppysyaqlivqaitmapdkqltlngiythitknypyyrtadkgw
    qnsirhnlslnryfikvprsqeepgkgsfwridpasesklieqafrkrrpr
    

    Sequence, based on observed residues (ATOM records): (download)
    >2c6yB (B:)
    dskppysyaqlivqaitmapdkqltlngiythitknypyyrtadkgwqnsirhnlslnry
    fikvprsqeepgkgsfwridpasesklieqafrkrr
    

  • Chain 'C':
    No sequence available.

  • Chain 'D':
    No sequence available.