PDB entry 2c6u

View 2c6u on RCSB PDB site
Description: crystal structure of human clec-2 (clec1b)
Class: lectin
Keywords: lectin, clec-2, rhodocytin, aggretin, c-type lectin-like, platelets, thrombosis, clec1b
Deposited on 2005-11-11, released 2006-11-20
The last revision prior to the SCOPe 2.01 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 1.6 Å
R-factor: 0.161
AEROSPACI score: 0.62 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: clec1b protein
  Species: Homo sapiens [TaxId:9606]
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q9P126 (0-121)
  Domains in SCOPe 2.01: d2c6ua_
• Heterogens: HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >2c6uA (A:)
  spcdtnwryygdscygffrhnltweeskqyctdmnatllkidnrniveyikarthlirwv
  glsrqksnevwkwedgsvisenmfefledgkgnmncayfhngkmhptfcenkhylmcerk
  ag