PDB entry 2c6p

View 2c6p on RCSB PDB site
Description: membrane-bound glutamate carboxypeptidase II (gcpii) in complex with phosphate anion
Class: hydrolase
Keywords: naaladase, neurodegenerative disease, peptidase, prostate cancer, psma, glycoprotein, hydrolase, alternative splicing, antigen, carboxypeptidase, dipeptidase, metal-binding, metalloprotease, multifunctional enzyme, polymorphism, signal-anchor, transmembrane, zinc
Deposited on 2005-11-11, released 2006-02-15
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.39 Å
R-factor: 0.2
AEROSPACI score: 0.33 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: glutamate carboxypeptidase II
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2c6pa1, d2c6pa2, d2c6pa3
  • Heterogens: ZN, CA, CL, NAG, PO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2c6pA (A:)
    kssneatnitpkhnmkafldelkaenikkflynftqiphlagteqnfqlakqiqsqwkef
    gldsvelahydvllsypnkthpnyisiinedgneifntslfeppppgyenvsdivppfsa
    fspqgmpegdlvyvnyartedffklerdmkincsgkiviarygkvfrgnkvknaqlagak
    gvilysdpadyfapgvksypdgwnlpgggvqrgnilnlngagdpltpgypaneyayrrgi
    aeavglpsipvhpigyydaqkllekmggsappdsswrgslkvpynvgpgftgnfstqkvk
    mhihstnevtriynvigtlrgavepdryvilgghrdswvfggidpqsgaavvheivrsfg
    tlkkegwrprrtilfaswdaeefgllgstewaeensrllqergvayinadssiegnytlr
    vdctplmyslvhnltkelkspdegfegkslyeswtkkspspefsgmprisklgsgndfev
    ffqrlgiasgrarytknwetnkfsgyplyhsvyetyelvekfydpmfkyhltvaqvrggm
    vfelansivlpfdcrdyavvlrkyadkiysismkhpqemktysvsfdslfsavknfteia
    skfserlqdfdksnpivlrmmndqlmflerafidplglpdrpfyrhviyapsshnkyage
    sfpgiydalfdieskvdpskawgevkrqiyvaaftvqaaaetlseva
    

    Sequence, based on observed residues (ATOM records): (download)
    >2c6pA (A:)
    nmkafldelkaenikkflynftqiphlagteqnfqlakqiqsqwkefgldsvelahydvl
    lsypnkthpnyisiinedgneifntslfeppppgyenvsdivppfsafspqgmpegdlvy
    vnyartedffklerdmkincsgkiviarygkvfrgnkvknaqlagakgvilysdpadyfa
    pgvksypdgwnlpgggvqrgnilnlngagdpltpgypaneyayrrgiaeavglpsipvhp
    igyydaqkllekmggsappdsswrgslkvpynvgpgfvkmhihstnevtriynvigtlrg
    avepdryvilgghrdswvfggidpqsgaavvheivrsfgtlkkegwrprrtilfaswdae
    efgllgstewaeensrllqergvayinadssiegnytlrvdctplmyslvhnltkelksp
    degfegkslyeswtkkspspefsgmprisklgsgndfevffqrlgiasgrarytkngypl
    yhsvyetyelvekfydpmfkyhltvaqvrggmvfelansivlpfdcrdyavvlrkyadki
    ysismkhpqemktysvsfdslfsavknfteiaskfserlqdfdnpivlrmmndqlmfler
    afidplglpdrpfyrhviyapsshnkyagesfpgiydalfdieskvdpskawgevkrqiy
    vaaftvqaaaetlseva