PDB entry 2c6e

View 2c6e on RCSB PDB site
Description: aurora a kinase activated mutant (t287d) in complex with a 5-aminopyrimidinyl quinazoline inhibitor
Class: transferase/inhibitor
Keywords: transferase/inhibitor, transferase/inhibitor complex, aurora, kinase, cancer, ATP-binding, cell cycle, nucleotide- binding, phosphorylation, serine/threonine-protein kinase, transferase
Deposited on 2005-11-09, released 2006-01-11
The last revision prior to the SCOPe 2.05 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.2
AEROSPACI score: 0.4 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: serine/threonine-protein kinase 6
    Species: Homo sapiens [TaxId:9606]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d2c6ea_
  • Chain 'B':
    Compound: serine/threonine-protein kinase 6
    Species: Homo sapiens [TaxId:9606]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d2c6eb_
  • Heterogens: HPM, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2c6eA (A:)
    gshmskkrqwaledfeigrplgkgkfgnvylarekqskfilalkvlfkaqlekagvehql
    rreveiqshlrhpnilrlygyfhdatrvylileyaplgtvyrelqklskfdeqrtatyit
    elanalsychskrvihrdikpenlllgsagelkiadfgwsvhapssrrtdlcgtldylpp
    emiegrmhdekvdlwslgvlcyeflvgkppfeantyqetykrisrveftfpdfvtegard
    lisrllkhnpsqrpmlrevlehpwitansskpsncqnkesask
    

    Sequence, based on observed residues (ATOM records): (download)
    >2c6eA (A:)
    qwaledfeigrplgkgkfgnvylarekqskfilalkvlfkaqlekagvehqlrreveiqs
    hlrhpnilrlygyfhdatrvylileyaplgtvyrelqklskfdeqrtatyitelanalsy
    chskrvihrdikpenlllgsagelkiadfgwsgtldylppemiegrmhdekvdlwslgvl
    cyeflvgkppfeantyqetykrisrveftfpdfvtegardlisrllkhnpsqrpmlrevl
    ehpwitanssk
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2c6eB (B:)
    gshmskkrqwaledfeigrplgkgkfgnvylarekqskfilalkvlfkaqlekagvehql
    rreveiqshlrhpnilrlygyfhdatrvylileyaplgtvyrelqklskfdeqrtatyit
    elanalsychskrvihrdikpenlllgsagelkiadfgwsvhapssrrtdlcgtldylpp
    emiegrmhdekvdlwslgvlcyeflvgkppfeantyqetykrisrveftfpdfvtegard
    lisrllkhnpsqrpmlrevlehpwitansskpsncqnkesask
    

    Sequence, based on observed residues (ATOM records): (download)
    >2c6eB (B:)
    qwaledfeigrplgkgkfgnvylarekqskfilalkvlfkaqlekagvehqlrreveiqs
    hlrhpnilrlygyfhdatrvylileyaplgtvyrelqklskfdeqrtatyitelanalsy
    chskrvihrdikpenlllgsagelkiadgtldylppemiegrmhdekvdlwslgvlcyef
    lvgkppfeantyqetykrisrveftfpdfvtegardlisrllkhnpsqrpmlrevlehpw
    itanss