PDB entry 2c6b

View 2c6b on RCSB PDB site
Description: solution structure of the c4 zinc-finger domain of hdm2
Class: ligase
Keywords: zinc finger, human mdm2, ligase, phosphorylation, alternative splicing, metal-binding, nuclear protein, proto- oncogene, ubl conjugation pathway, zinc
Deposited on 2005-11-08, released 2006-01-04
The last revision prior to the SCOPe 2.03 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: ubiquitin-protein ligase e3 mdm2
  Species: Homo sapiens [TaxId:9606]
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q00987 (0-45)
  Domains in SCOPe 2.03: d2c6ba1
• Heterogens: ZN

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >2c6bA (A:)
  sfeedpeisladywkctscnemnpplpshcnrcwalrenwlpedkg