PDB entry 2c6a

View 2c6a on RCSB PDB site
Description: Solution structure of the C4 zinc-finger domain of HDM2
Class: ligase
Keywords: zinc finger, human mdm2, ligase, phosphorylation, alternative splicing, metal-binding, nuclear protein, proto- oncogene, ubl conjugation pathway, zinc
Deposited on 2005-11-08, released 2006-01-04
The last revision prior to the SCOPe 2.08 freeze date was dated 2018-01-24, with a file datestamp of 2018-01-19.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: ubiquitin-protein ligase e3 mdm2
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d2c6aa1
  • Heterogens: ZN

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2c6aA (A:)
    sfeedpeisladywkctscnemnpplpshcnrcwalrenwlpedkg