PDB entry 2c62

View 2c62 on RCSB PDB site
Description: crystal structure of the human transcription cofactor pc4 in complex with single-stranded DNA
Class: transcription
Keywords: transcription cofactor, single-stranded DNA, protein-DNA complex, DNA unwinding, activator, DNA-binding, nuclear protein, phosphorylation, transcription, transcription regulation
Deposited on 2005-11-07, released 2006-01-11
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.74 Å
R-factor: 0.229
AEROSPACI score: 0.5 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: activated RNA polymerase II transcriptional coactivator p15
  Species: Homo sapiens [TaxId:9606]
  Database cross-references and differences (RAF-indexed):
  • PDB 2C62
  • Uniprot P53999 (1-65)
  Domains in SCOPe 2.06: d2c62a2, d2c62a3
• Chain 'B':
  Compound: activated RNA polymerase II transcriptional coactivator p15
  Species: Homo sapiens [TaxId:9606]
  Database cross-references and differences (RAF-indexed):
  • PDB 2C62
  • Uniprot P53999 (1-65)
  Domains in SCOPe 2.06: d2c62b2, d2c62b3
• Chain 'C':
  Compound: 5'-d(*tp*tp*tp*tp*tp*tp*tp*tp*tp*tp *tp*tp*tp*tp*tp*tp*tp*tp*tp*g)-3'
  
• Heterogens: SO4, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >2c62A (A:)
  amfqigkmryvsvrdfkgkvlidireywmdpegemkpgrkgislnpeqwsqlkeqisdid
  davrkl
  

  
  
• Chain 'B':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >2c62B (B:)
  amfqigkmryvsvrdfkgkvlidireywmdpegemkpgrkgislnpeqwsqlkeqisdid
  davrkl
  

  
  
• Chain 'C':
  No sequence available.