PDB entry 2c5w

View 2c5w on RCSB PDB site
Description: penicillin-binding protein 1a (pbp-1a) acyl-enzyme complex (cefotaxime) from streptococcus pneumoniae
Class: transferase/hydrolase
Keywords: peptidoglycan synthesis, transferase-hydrolase complex, antibiotic resistance, cell shape, multifunctional enzyme
Deposited on 2005-11-02, released 2005-12-07
The last revision prior to the SCOPe 2.08 freeze date was dated 2018-10-03, with a file datestamp of 2018-09-28.
Experiment type: XRAY
Resolution: 2.55 Å
R-factor: N/A
AEROSPACI score: 0.2 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: penicillin-binding protein 1a
    Species: Streptococcus pneumoniae [TaxId:171101]
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: penicillin-binding protein 1a
    Species: Streptococcus pneumoniae [TaxId:171101]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8DR59 (0-384)
      • conflict (274)
    Domains in SCOPe 2.08: d2c5wb1
  • Heterogens: ZN, CL, EDO, CEF, HOH

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2c5wB (B:)
    snypaymdnylkevinqveeetgynllttgmdvytnvdqeaqkhlwdiyntdeyvaypdd
    elqvastivdvsngkviaqlgarhqssnvsfginqavetnrdwgstmkpitdyapaleyg
    vyestativhdepynypgtntpvynwdrgyfgnitlqyalqqsrnvpavetlnkvglnra
    ktflnglgidypsihysnaissnttesdkkygassekmaaayaafanggtyykpmyihkv
    vfsdgsekefsnvgtramkettaymmtdmmktvltygtgrnaylawlpqagktgtsnytd
    eeienhiktsqfvapdelfagytrkysmavwtgysnrltplvgngltvaakvyrsmmtyl
    segsnpedwnipeglyrngefvfkn