PDB entry 2c5s

View 2c5s on RCSB PDB site
Description: crystal structure of bacillus anthracis thii, a tRNA-modifying enzyme containing the predicted RNA-binding thump domain
Class: RNA-binding protein
Keywords: RNA-binding protein, RNA binding protein, tRNA modification, 4-thiouridine synthase, ferredoxin-like domain, thump domain, pp-loop pyrophosphatase domain, thiamine biosynthesis
Deposited on 2005-11-01, released 2005-11-30
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-31.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.229
AEROSPACI score: 0.29 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: probable thiamine biosynthesis protein thii
    Species: BACILLUS ANTHRACIS [TaxId:198094]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2c5sa1, d2c5sa2
  • Heterogens: AMP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2c5sA (A:)
    mgsshhhhhhmtyeyilvrygemttkgknrskfvstlkdnvkfklkkfpnikidathdrm
    yiqlngedheavserlkdvfgihkfnlamkvpseledikkgalaaflqvkgdvktfkitv
    hrsykhfpmrtmellpeigghilenteditvdvhnpdvnvrveirsgysyimcdermgag
    glpvgvggkvmvllsggidspvaayltmkrgvsveavhfhsppftserakqkvidlaqel
    tkyckrvtlhlvpftevqktinkeipssysmtvmrrmmmriteriaeernalaittgesl
    gqvasqtldsmhtinevtnypvirplitmdkleiikiaeeigtydisirpyedcctvftp
    aspatkpkrekanrfeakydftplideavanketmvlqtvevvaeeekfeelf
    

    Sequence, based on observed residues (ATOM records): (download)
    >2c5sA (A:)
    yeyilvrygemgknrskfvstlkdnvkfklkkfpnikidathdrmyiqlngedheavser
    lkdvfgihkfnlamkvpseledikkgalaaflqvkgdvktfkitvhrsykhfpmrtmell
    peigghilenteditvdvhnpdvnvrveirsgysyimcdermgagglpvgvggkvmvlls
    ggidspvaayltmkrgvsveavhfhsppftserakqkvidlaqeltkyckrvtlhlvpft
    evqktinkeipssysmtvmrrmmmriteriaeernalaittgeslgqvasqtldsmhtin
    evtnypvirplitmdkleiikiaeeigtydisirpykpkrekanrfeakydftplideav
    anketmvlqtve