PDB entry 2c5r

View 2c5r on RCSB PDB site
Description: the structure of phage phi29 replication organizer protein p16.7 in complex with double stranded DNA
Class: complex (DNA-binding protein/DNA)
Keywords: DNA-binding protein, complex (DNA-binding protein/DNA)
Deposited on 2005-10-31, released 2005-11-08
The last revision prior to the SCOP 1.73 freeze date was dated 2006-01-04, with a file datestamp of 2007-06-28.
Experiment type: XRAY
Resolution: 2.9 Å
R-factor: 0.25413
AEROSPACI score: 0.19 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: early protein p16.7
    Species: Bacteriophage phi-29
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d2c5ra1
  • Chain 'B':
    Compound: early protein p16.7
    Species: Bacteriophage phi-29
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d2c5rb1
  • Chain 'C':
    Compound: early protein p16.7
    Species: Bacteriophage phi-29
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d2c5rc1
  • Chain 'D':
    Compound: early protein p16.7
    Species: Bacteriophage phi-29
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d2c5rd1
  • Chain 'E':
    Compound: early protein p16.7
    Species: Bacteriophage phi-29
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d2c5re1
  • Chain 'F':
    Compound: early protein p16.7
    Species: Bacteriophage phi-29
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d2c5rf1
  • Chain 'Y':
    Compound: 5'-d(*tp*cp*cp*ap*cp*cp*gp*gp)-3'
  • Chain 'Z':
    Compound: 5'-d(*cp*cp*gp*gp*tp*gp*gp*ap)-3'
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2c5rA (A:)
    ktvnlsacevavldlyeqsniripsdiiedlvnqrlqseqevlnyietqrtywklenqkk
    lyrgslk
    

    Sequence, based on observed residues (ATOM records): (download)
    >2c5rA (A:)
    nlsacevavldlyeqsniripsdiiedlvnqrlqseqevlnyietqrtywklenqkklyr
    gslk
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2c5rB (B:)
    ktvnlsacevavldlyeqsniripsdiiedlvnqrlqseqevlnyietqrtywklenqkk
    lyrgslk
    

    Sequence, based on observed residues (ATOM records): (download)
    >2c5rB (B:)
    nlsacevavldlyeqsniripsdiiedlvnqrlqseqevlnyietqrtywklenqkklyr
    gslk
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >2c5rC (C:)
    ktvnlsacevavldlyeqsniripsdiiedlvnqrlqseqevlnyietqrtywklenqkk
    lyrgslk
    

    Sequence, based on observed residues (ATOM records): (download)
    >2c5rC (C:)
    nlsacevavldlyeqsniripsdiiedlvnqrlqseqevlnyietqrtywklenqkklyr
    gslk
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >2c5rD (D:)
    ktvnlsacevavldlyeqsniripsdiiedlvnqrlqseqevlnyietqrtywklenqkk
    lyrgslk
    

    Sequence, based on observed residues (ATOM records): (download)
    >2c5rD (D:)
    nlsacevavldlyeqsniripsdiiedlvnqrlqseqevlnyietqrtywklenqkklyr
    gslk
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >2c5rE (E:)
    ktvnlsacevavldlyeqsniripsdiiedlvnqrlqseqevlnyietqrtywklenqkk
    lyrgslk
    

    Sequence, based on observed residues (ATOM records): (download)
    >2c5rE (E:)
    nlsacevavldlyeqsniripsdiiedlvnqrlqseqevlnyietqrtywklenqkklyr
    gslk
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >2c5rF (F:)
    ktvnlsacevavldlyeqsniripsdiiedlvnqrlqseqevlnyietqrtywklenqkk
    lyrgslk
    

    Sequence, based on observed residues (ATOM records): (download)
    >2c5rF (F:)
    nlsacevavldlyeqsniripsdiiedlvnqrlqseqevlnyietqrtywklenqkklyr
    gslk
    

  • Chain 'Y':
    No sequence available.

  • Chain 'Z':
    No sequence available.