PDB entry 2c5l

View 2c5l on RCSB PDB site
Description: structure of plc epsilon ras association domain with hras
Class: signaling protein
Keywords: signaling protein/complex, ras, ubiquitin superfold, oncogene, GTP-binding, nucleotide- binding, signaling protein, disease mutation, lipoprotein, palmitate, prenylation, proto-oncogene
Deposited on 2005-10-27, released 2006-02-20
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.187
AEROSPACI score: 0.47 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: gtpase hras
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 2C5L
      • engineered mutation (18)
    • Uniprot P01112 (7-172)
    Domains in SCOPe 2.06: d2c5la_
  • Chain 'B':
    Compound: gtpase hras
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 2C5L
      • engineered mutation (18)
    • Uniprot P01112 (7-172)
    Domains in SCOPe 2.06: d2c5lb_
  • Chain 'C':
    Compound: phosphoinositide-specific phospholipase c plc-epsilon
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2c5lc1
  • Chain 'D':
    Compound: phosphoinositide-specific phospholipase c plc-epsilon
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2c5ld_
  • Heterogens: GTP, MG, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2c5lA (A:)
    gggsggsmteyklvvvgavgvgksaltiqliqnhfvdeydptiedsyrkqvvidgetcll
    dildtagqeeysamrdqymrtgegflcvfainntksfedihqyreqikrvkdsddvpmvl
    vgnkcdlaartvesrqaqdlarsygipyietsaktrqgvedafytlvreirqh
    

    Sequence, based on observed residues (ATOM records): (download)
    >2c5lA (A:)
    mteyklvvvgavgvgksaltiqliqnhfvdeydptiedsyrkqvvidgetclldildtag
    qeeysamrdqymrtgegflcvfainntksfedihqyreqikrvkdsddvpmvlvgnkcdl
    aartvesrqaqdlarsygipyietsaktrqgvedafytlvreirqh
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2c5lB (B:)
    gggsggsmteyklvvvgavgvgksaltiqliqnhfvdeydptiedsyrkqvvidgetcll
    dildtagqeeysamrdqymrtgegflcvfainntksfedihqyreqikrvkdsddvpmvl
    vgnkcdlaartvesrqaqdlarsygipyietsaktrqgvedafytlvreirqh
    

    Sequence, based on observed residues (ATOM records): (download)
    >2c5lB (B:)
    mteyklvvvgavgvgksaltiqliqnhfvdeydptiedsyrkqvvidgetclldildtag
    qeeysamrdqymrtgegflcvfainntksfedihqyreqikrvkdsddvpmvlvgnkcdl
    aartvesrqaqdlarsygipyietsaktrqgvedafytlvreirqh
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >2c5lC (C:)
    gsseeesffvqvhdvspeqprtvikaprvstaqdviqqtlckakyslsilsnpnpsdyvl
    leevvkdttnkktttpkssqrvlldqecvfqaqskwkgagkfilklkeqvqasredk
    

    Sequence, based on observed residues (ATOM records): (download)
    >2c5lC (C:)
    eesffvqvhdvspeqprtvikaprvstaqdviqqtlckakyslsilsnpnpsdyvlleev
    vkdkssqrvlldqecvfqaqskwkgagkfilklkeqv
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >2c5lD (D:)
    gsseeesffvqvhdvspeqprtvikaprvstaqdviqqtlckakyslsilsnpnpsdyvl
    leevvkdttnkktttpkssqrvlldqecvfqaqskwkgagkfilklkeqvqasredk
    

    Sequence, based on observed residues (ATOM records): (download)
    >2c5lD (D:)
    eesffvqvhdvspeqprtvikaprvstaqdviqqtlckakyslsilsnpnpsdyvlleev
    sqrvlldqecvfkfilklkeq