PDB entry 2c5e

View 2c5e on RCSB PDB site
Description: GDP-mannose-3', 5' -epimerase (arabidopsis thaliana), k217a, with GDP-alpha-d-mannose bound in the active site.
Class: isomerase
Keywords: 3' 5'-epimerase, short chain dehydratase/reductase, GDP-mannose, GDP-gulose, GDP-galactose, keto intermediate, vitamin c, ascorbate biosynthesis, isomerase, nad
Deposited on 2005-10-26, released 2005-11-14
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: 0.134
AEROSPACI score: 0.59 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: GDP-mannose-3', 5'-epimerase
    Species: Arabidopsis thaliana [TaxId:3702]
    Database cross-references and differences (RAF-indexed):
    • PDB 2C5E
      • engineered mutation (218)
    • Uniprot Q93VR3
    Domains in SCOPe 2.07: d2c5ea1
  • Chain 'B':
    Compound: GDP-mannose-3', 5'-epimerase
    Species: Arabidopsis thaliana [TaxId:3702]
    Database cross-references and differences (RAF-indexed):
    • PDB 2C5E
      • engineered mutation (218)
    • Uniprot Q93VR3
    Domains in SCOPe 2.07: d2c5eb_
  • Heterogens: GDD, FMT, NAD, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2c5eA (A:)
    gamgttngtdygaytykelereqywpsenlkisitgaggfiashiarrlkheghyviasd
    wkknehmtedmfcdefhlvdlrvmenclkvtegvdhvfnlaadmggmgfiqsnhsvimyn
    ntmisfnmieaaringikrffyassaciypefkqlettnvslkesdawpaepqdayglek
    lateelckhynkdfgiecrigrfhniygpfgtwkggreaapaafcrkaqtstdrfemwgd
    glqtrsftfidecvegvlrltksdfrepvnigsdemvsmnemaemvlsfeekklpihhip
    gpegvrgrnsdnnlikeklgwapnmrlkeglrityfwikeqiekekakgsdvslygsskv
    vgtqapvqlgslraadgke
    

    Sequence, based on observed residues (ATOM records): (download)
    >2c5eA (A:)
    tykelereqywpsenlkisitgaggfiashiarrlkheghyviasdwkknehmtedmfcd
    efhlvdlrvmenclkvtegvdhvfnlaadmggmgfiqsnhsvimynntmisfnmieaari
    ngikrffyassaciypefkqlettnvslkesdawpaepqdaygleklateelckhynkdf
    giecrigrfhniygpfgtwkggreaapaafcrkaqtstdrfemwgdglqtrsftfidecv
    egvlrltksdfrepvnigsdemvsmnemaemvlsfeekklpihhipgpegvrgrnsdnnl
    ikeklgwapnmrlkeglrityfwikeqiekekakgsdvslygsskvvgtqapvqlgslra
    adg
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2c5eB (B:)
    gamgttngtdygaytykelereqywpsenlkisitgaggfiashiarrlkheghyviasd
    wkknehmtedmfcdefhlvdlrvmenclkvtegvdhvfnlaadmggmgfiqsnhsvimyn
    ntmisfnmieaaringikrffyassaciypefkqlettnvslkesdawpaepqdayglek
    lateelckhynkdfgiecrigrfhniygpfgtwkggreaapaafcrkaqtstdrfemwgd
    glqtrsftfidecvegvlrltksdfrepvnigsdemvsmnemaemvlsfeekklpihhip
    gpegvrgrnsdnnlikeklgwapnmrlkeglrityfwikeqiekekakgsdvslygsskv
    vgtqapvqlgslraadgke
    

    Sequence, based on observed residues (ATOM records): (download)
    >2c5eB (B:)
    ytykelereqywpsenlkisitgaggfiashiarrlkheghyviasdwkknehmtedmfc
    defhlvdlrvmenclkvtegvdhvfnlaadmggmgfiqsnhsvimynntmisfnmieaar
    ingikrffyassaciypefkqlettnvslkesdawpaepqdaygleklateelckhynkd
    fgiecrigrfhniygpfgtwkggreaapaafcrkaqtstdrfemwgdglqtrsftfidec
    vegvlrltksdfrepvnigsdemvsmnemaemvlsfeekklpihhipgpegvrgrnsdnn
    likeklgwapnmrlkeglrityfwikeqiekekakgsdvslygsskvvgtqapvqlgslr
    a