PDB entry 2c5b

View 2c5b on RCSB PDB site
Description: x-ray crystal structure of 5'-fluorodeoxyadenosine synthase from streptomyces cattleya complexed with 2'deoxy-5'deoxy-fluoroadenosine.
Class: transferase
Keywords: transferase, fluorinase, 5'-fluorodeoxyadenosine synthase, fla, inhibitor, aza, streptomyces cattleya, sam analogue
Deposited on 2005-10-26, released 2007-02-20
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: 0.193
AEROSPACI score: 0.33 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 5'-fluoro-5'-deoxyadenosine synthase
    Species: STREPTOMYCES CATTLEYA [TaxId:29303]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d2c5ba1, d2c5ba2
  • Chain 'B':
    Compound: 5'-fluoro-5'-deoxyadenosine synthase
    Species: STREPTOMYCES CATTLEYA [TaxId:29303]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d2c5bb1, d2c5bb2
  • Chain 'C':
    Compound: 5'-fluoro-5'-deoxyadenosine synthase
    Species: STREPTOMYCES CATTLEYA [TaxId:29303]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d2c5bc1, d2c5bc2
  • Heterogens: MET, 5F1, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2c5bA (A:)
    maanstrrpiiafmsdlgttddsvaqckglmysicpdvtvvdvchsmtpwdveegaryiv
    dlprffpegtvfatttypatgtttrsvavrikqaakggargqwagsgagferaegsyiyi
    apnngllttvleehgyleayevtspkvipeqpeptfysremvaipsahlaagfplsevgr
    pledheivrfnrpaveqdgealvgvvsaidhpfgnvwtnihrtdlekagigygarlrltl
    dgvlpfeapltptfadageigniaiylnsrgylsiarnaaslaypyhlkegmsarvear
    

    Sequence, based on observed residues (ATOM records): (download)
    >2c5bA (A:)
    rpiiafmsdlgttddsvaqckglmysicpdvtvvdvchsmtpwdveegaryivdlprffp
    egtvfatttypatgtttrsvavrikqaakggargqwagsgagferaegsyiyiapnngll
    ttvleehgyleayevtspkvipeqpeptfysremvaipsahlaagfplsevgrpledhei
    vrfnrpaveqdgealvgvvsaidhpfgnvwtnihrtdlekagigygarlrltldgvlpfe
    apltptfadageigniaiylnsrgylsiarnaaslaypyhlkegmsarvea
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2c5bB (B:)
    maanstrrpiiafmsdlgttddsvaqckglmysicpdvtvvdvchsmtpwdveegaryiv
    dlprffpegtvfatttypatgtttrsvavrikqaakggargqwagsgagferaegsyiyi
    apnngllttvleehgyleayevtspkvipeqpeptfysremvaipsahlaagfplsevgr
    pledheivrfnrpaveqdgealvgvvsaidhpfgnvwtnihrtdlekagigygarlrltl
    dgvlpfeapltptfadageigniaiylnsrgylsiarnaaslaypyhlkegmsarvear
    

    Sequence, based on observed residues (ATOM records): (download)
    >2c5bB (B:)
    rpiiafmsdlgttddsvaqckglmysicpdvtvvdvchsmtpwdveegaryivdlprffp
    egtvfatttypatgtttrsvavrikqaakggargqwagsgagferaegsyiyiapnngll
    ttvleehgyleayevtspkvipeqpeptfysremvaipsahlaagfplsevgrpledhei
    vrfnrpaveqdgealvgvvsaidhpfgnvwtnihrtdlekagigygarlrltldgvlpfe
    apltptfadageigniaiylnsrgylsiarnaaslaypyhlkegmsarvea
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >2c5bC (C:)
    maanstrrpiiafmsdlgttddsvaqckglmysicpdvtvvdvchsmtpwdveegaryiv
    dlprffpegtvfatttypatgtttrsvavrikqaakggargqwagsgagferaegsyiyi
    apnngllttvleehgyleayevtspkvipeqpeptfysremvaipsahlaagfplsevgr
    pledheivrfnrpaveqdgealvgvvsaidhpfgnvwtnihrtdlekagigygarlrltl
    dgvlpfeapltptfadageigniaiylnsrgylsiarnaaslaypyhlkegmsarvear
    

    Sequence, based on observed residues (ATOM records): (download)
    >2c5bC (C:)
    rpiiafmsdlgttddsvaqckglmysicpdvtvvdvchsmtpwdveegaryivdlprffp
    egtvfatttypatgtttrsvavrikqaakggargqwagsgagferaegsyiyiapnngll
    ttvleehgyleayevtspkvipeqpeptfysremvaipsahlaagfplsevgrpledhei
    vrfnrpaveqdgealvgvvsaidhpfgnvwtnihrtdlekagigygarlrltldgvlpfe
    apltptfadageigniaiylnsrgylsiarnaaslaypyhlkegmsarvea