PDB entry 2c5a

View 2c5a on RCSB PDB site
Description: GDP-mannose-3', 5'-epimerase (arabidopsis thaliana), y174f, with GDP-beta-l-galactose bound in the active site
Class: isomerase
Keywords: 3' 5'-epimerase, short chain dehydratase/reductase, GDP-mannose, GDP-gulose, GDP-galactose, keto intermediate, vitamin c, sdr, ascorbate biosynthesis, isomerase, nad
Deposited on 2005-10-26, released 2005-11-14
The last revision prior to the SCOP 1.73 freeze date was dated 2006-01-04, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 1.4 Å
R-factor: 0.105
AEROSPACI score: 0.61 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: GDP-mannose-3', 5'-epimerase
    Species: Arabidopsis thaliana
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d2c5aa1
  • Chain 'B':
    Compound: GDP-mannose-3', 5'-epimerase
    Species: Arabidopsis thaliana
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d2c5ab1
  • Heterogens: GDC, NAD, BTB, FMT, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2c5aA (A:)
    gamgttngtdygaytykelereqywpsenlkisitgaggfiashiarrlkheghyviasd
    wkknehmtedmfcdefhlvdlrvmenclkvtegvdhvfnlaadmggmgfiqsnhsvimyn
    ntmisfnmieaaringikrffyassaciypefkqlettnvslkesdawpaepqdafglek
    lateelckhynkdfgiecrigrfhniygpfgtwkggrekapaafcrkaqtstdrfemwgd
    glqtrsftfidecvegvlrltksdfrepvnigsdemvsmnemaemvlsfeekklpihhip
    gpegvrgrnsdnnlikeklgwapnmrlkeglrityfwikeqiekekakgsdvslygsskv
    vgtqapvqlgslraadgke
    

    Sequence, based on observed residues (ATOM records): (download)
    >2c5aA (A:)
    tykelereqywpsenlkisitgaggfiashiarrlkheghyviasdwkknehmtedmfcd
    efhlvdlrvmenclkvtegvdhvfnlaadmggmgfiqsnhsvimynntmisfnmieaari
    ngikrffyassaciypefkqlettnvslkesdawpaepqdafgleklateelckhynkdf
    giecrigrfhniygpfgtwkggrekapaafcrkaqtstdrfemwgdglqtrsftfidecv
    egvlrltksdfrepvnigsdemvsmnemaemvlsfeekklpihhipgpegvrgrnsdnnl
    ikeklgwapnmrlkeglrityfwikeqiekekakgsdvslygsskvvgtqapvqlgslra
    adgk
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2c5aB (B:)
    gamgttngtdygaytykelereqywpsenlkisitgaggfiashiarrlkheghyviasd
    wkknehmtedmfcdefhlvdlrvmenclkvtegvdhvfnlaadmggmgfiqsnhsvimyn
    ntmisfnmieaaringikrffyassaciypefkqlettnvslkesdawpaepqdafglek
    lateelckhynkdfgiecrigrfhniygpfgtwkggrekapaafcrkaqtstdrfemwgd
    glqtrsftfidecvegvlrltksdfrepvnigsdemvsmnemaemvlsfeekklpihhip
    gpegvrgrnsdnnlikeklgwapnmrlkeglrityfwikeqiekekakgsdvslygsskv
    vgtqapvqlgslraadgke
    

    Sequence, based on observed residues (ATOM records): (download)
    >2c5aB (B:)
    ytykelereqywpsenlkisitgaggfiashiarrlkheghyviasdwkknehmtedmfc
    defhlvdlrvmenclkvtegvdhvfnlaadmggmgfiqsnhsvimynntmisfnmieaar
    ingikrffyassaciypefkqlettnvslkesdawpaepqdafgleklateelckhynkd
    fgiecrigrfhniygpfgtwkggrekapaafcrkaqtstdrfemwgdglqtrsftfidec
    vegvlrltksdfrepvnigsdemvsmnemaemvlsfeekklpihhipgpegvrgrnsdnn
    likeklgwapnmrlkeglrityfwikeqiekekakgsdvslygsskvvgtqapvqlgslr
    a