PDB entry 2c59

View 2c59 on RCSB PDB site
Description: GDP-mannose-3', 5'-epimerase (arabidopsis thaliana), with GDP-alpha-d-mannose and GDP-beta-l-galactose bound in the active site.
Class: isomerase
Keywords: 3' 5'-epimerase, short chain dehydratase/reductase, GDP-mannose, GDP-gulose, GDP-galactose, keto intermediate, vitamin c, ascorbate biosynthesis, isomerase
Deposited on 2005-10-26, released 2005-11-14
The last revision prior to the SCOP 1.73 freeze date was dated 2006-01-04, with a file datestamp of 2007-06-28.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.15138
AEROSPACI score: 0.35 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: GDP-mannose-3', 5'-epimerase
    Species: Arabidopsis thaliana
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d2c59a1
  • Chain 'B':
    Compound: GDP-mannose-3', 5'-epimerase
    Species: Arabidopsis thaliana
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d2c59b1
  • Heterogens: GDD, NAD, BTB, FMT, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2c59A (A:)
    gamgttngtdygaytykelereqywpsenlkisitgaggfiashiarrlkheghyviasd
    wkknehmtedmfcdefhlvdlrvmenclkvtegvdhvfnlaadmggmgfiqsnhsvimyn
    ntmisfnmieaaringikrffyassaciypefkqlettnvslkesdawpaepqdayglek
    lateelckhynkdfgiecrigrfhniygpfgtwkggrekapaafcrkaqtstdrfemwgd
    glqtrsftfidecvegvlrltksdfrepvnigsdemvsmnemaemvlsfeekklpihhip
    gpegvrgrnsdnnlikeklgwapnmrlkeglrityfwikeqiekekakgsdvslygsskv
    vgtqapvqlgslraadgke
    

    Sequence, based on observed residues (ATOM records): (download)
    >2c59A (A:)
    ytykelereqywpsenlkisitgaggfiashiarrlkheghyviasdwkknehmtedmfc
    defhlvdlrvmenclkvtegvdhvfnlaadmggmgfiqsnhsvimynntmisfnmieaar
    ingikrffyassaciypefkqlettnvslkesdawpaepqdaygleklateelckhynkd
    fgiecrigrfhniygpfgtwkggrekapaafcrkaqtstdrfemwgdglqtrsftfidec
    vegvlrltksdfrepvnigsdemvsmnemaemvlsfeekklpihhipgpegvrgrnsdnn
    likeklgwapnmrlkeglrityfwikeqiekekakgsdvslygsskvvgtqapvqlgslr
    aadg
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2c59B (B:)
    gamgttngtdygaytykelereqywpsenlkisitgaggfiashiarrlkheghyviasd
    wkknehmtedmfcdefhlvdlrvmenclkvtegvdhvfnlaadmggmgfiqsnhsvimyn
    ntmisfnmieaaringikrffyassaciypefkqlettnvslkesdawpaepqdayglek
    lateelckhynkdfgiecrigrfhniygpfgtwkggrekapaafcrkaqtstdrfemwgd
    glqtrsftfidecvegvlrltksdfrepvnigsdemvsmnemaemvlsfeekklpihhip
    gpegvrgrnsdnnlikeklgwapnmrlkeglrityfwikeqiekekakgsdvslygsskv
    vgtqapvqlgslraadgke
    

    Sequence, based on observed residues (ATOM records): (download)
    >2c59B (B:)
    gaytykelereqywpsenlkisitgaggfiashiarrlkheghyviasdwkknehmtedm
    fcdefhlvdlrvmenclkvtegvdhvfnlaadmggmgfiqsnhsvimynntmisfnmiea
    aringikrffyassaciypefkqlettnvslkesdawpaepqdaygleklateelckhyn
    kdfgiecrigrfhniygpfgtwkggrekapaafcrkaqtstdrfemwgdglqtrsftfid
    ecvegvlrltksdfrepvnigsdemvsmnemaemvlsfeekklpihhipgpegvrgrnsd
    nnlikeklgwapnmrlkeglrityfwikeqiekekakgsdvslygsskvvgtqapvqlgs
    lr