PDB entry 2c54

View 2c54 on RCSB PDB site
Description: GDP-mannose-3', 5' -epimerase (arabidopsis thaliana), k178r, with GDP-beta-l-gulose and GDP-4-keto-beta-l-gulose bound in active site.
Class: isomerase
Keywords: 3' 5'-epimerase, short chain dehydratase/reductase, GDP-mannose, GDP-gulose, GDP-galactose, keto intermediate, vitamin c, sdr, isomerase, ascorbate biosynthesis, nad
Deposited on 2005-10-25, released 2005-11-14
The last revision prior to the SCOPe 2.04 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.5 Å
R-factor: 0.121
AEROSPACI score: 0.69 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: GDP-mannose-3', 5'-epimerase
    Species: Arabidopsis thaliana [TaxId:3702]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • PDB 2C54
      • engineered mutation (179)
    • Uniprot Q93VR3
    Domains in SCOPe 2.04: d2c54a1
  • Chain 'B':
    Compound: GDP-mannose-3', 5'-epimerase
    Species: Arabidopsis thaliana [TaxId:3702]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • PDB 2C54
      • engineered mutation (179)
    • Uniprot Q93VR3
    Domains in SCOPe 2.04: d2c54b_
  • Heterogens: GKE, GKD, NAD, FMT, EPE, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2c54A (A:)
    gamgttngtdygaytykelereqywpsenlkisitgaggfiashiarrlkheghyviasd
    wkknehmtedmfcdefhlvdlrvmenclkvtegvdhvfnlaadmggmgfiqsnhsvimyn
    ntmisfnmieaaringikrffyassaciypefkqlettnvslkesdawpaepqdaygler
    lateelckhynkdfgiecrigrfhniygpfgtwkggrekapaafcrkaqtstdrfemwgd
    glqtrsftfidecvegvlrltksdfrepvnigsdemvsmnemaemvlsfeekklpihhip
    gpegvrgrnsdnnlikeklgwapnmrlkeglrityfwikeqiekekakgsdvslygsskv
    vgtqapvqlgslraadgke
    

    Sequence, based on observed residues (ATOM records): (download)
    >2c54A (A:)
    tykelereqywpsenlkisitgaggfiashiarrlkheghyviasdwkknehmtedmfcd
    efhlvdlrvmenclkvtegvdhvfnlaadmggmgfiqsnhsvimynntmisfnmieaari
    ngikrffyassaciypefkqlettnvslkesdawpaepqdayglerlateelckhynkdf
    giecrigrfhniygpfgtwkggrekapaafcrkaqtstdrfemwgdglqtrsftfidecv
    egvlrltksdfrepvnigsdemvsmnemaemvlsfeekklpihhipgpegvrgrnsdnnl
    ikeklgwapnmrlkeglrityfwikeqiekekakgsdvslygsskvvgtqapvqlgslra
    ad
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2c54B (B:)
    gamgttngtdygaytykelereqywpsenlkisitgaggfiashiarrlkheghyviasd
    wkknehmtedmfcdefhlvdlrvmenclkvtegvdhvfnlaadmggmgfiqsnhsvimyn
    ntmisfnmieaaringikrffyassaciypefkqlettnvslkesdawpaepqdaygler
    lateelckhynkdfgiecrigrfhniygpfgtwkggrekapaafcrkaqtstdrfemwgd
    glqtrsftfidecvegvlrltksdfrepvnigsdemvsmnemaemvlsfeekklpihhip
    gpegvrgrnsdnnlikeklgwapnmrlkeglrityfwikeqiekekakgsdvslygsskv
    vgtqapvqlgslraadgke
    

    Sequence, based on observed residues (ATOM records): (download)
    >2c54B (B:)
    ytykelereqywpsenlkisitgaggfiashiarrlkheghyviasdwkknehmtedmfc
    defhlvdlrvmenclkvtegvdhvfnlaadmggmgfiqsnhsvimynntmisfnmieaar
    ingikrffyassaciypefkqlettnvslkesdawpaepqdayglerlateelckhynkd
    fgiecrigrfhniygpfgtwkggrekapaafcrkaqtstdrfemwgdglqtrsftfidec
    vegvlrltksdfrepvnigsdemvsmnemaemvlsfeekklpihhipgpegvrgrnsdnn
    likeklgwapnmrlkeglrityfwikeqiekekakgsdvslygsskvvgtqapvqlgslr