PDB entry 2c4z

View 2c4z on RCSB PDB site
Description: ms2-RNA hairpin (2su -5-6) complex
Class: virus/RNA
Keywords: VIRUS/RNA, CAPSID, COMPLEX (CAPSID PROTEIN-RNA HAIRPIN), HAIRPIN, LEVIVIRUS, VIRUS/VIRAL PROTEIN/RNA, VIRUS COAT PROTEIN, RNA- BINDING, ICOSAHEDRAL VIRUS, VIRUS-RNA complex
Deposited on 2005-10-25, released 2006-01-05
The last revision prior to the SCOPe 2.07 freeze date was dated 2012-01-25, with a file datestamp of 2012-01-20.
Experiment type: XRAY
Resolution: 2.6 Å
R-factor: 0.191
AEROSPACI score: 0.32 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: coat protein
    Species: Enterobacterio phage MS2 [TaxId:12022]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2c4za_
  • Chain 'B':
    Compound: coat protein
    Species: Enterobacterio phage MS2 [TaxId:12022]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2c4zb_
  • Chain 'C':
    Compound: coat protein
    Species: Enterobacterio phage MS2 [TaxId:12022]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2c4zc_
  • Chain 'R':
    Compound: 5'-r(*ap*cp*ap*up*gp*ap*gp*gp*ap*sur *sur*ap*cp*cp*cp*ap*up*gp*u)-3'
    Species: ENTEROBACTERIO PHAGE MS2, synthetic [TaxId:12022]
  • Chain 'S':
    Compound: 5'-r(*ap*cp*ap*up*gp*ap*gp*gp*ap*sur *sur*ap*cp*cp*cp*ap*up*gp*u)-3'
    Species: ENTEROBACTERIO PHAGE MS2, synthetic [TaxId:12022]
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2c4zA (A:)
    asnftqfvlvdnggtgdvtvapsnfangvaewissnsrsqaykvtcsvrqssaqnrkyti
    kvevpkvatqtvggvelpvaawrsylnmeltipifatnsdcelivkamqgllkdgnpips
    aiaansgiy
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2c4zB (B:)
    asnftqfvlvdnggtgdvtvapsnfangvaewissnsrsqaykvtcsvrqssaqnrkyti
    kvevpkvatqtvggvelpvaawrsylnmeltipifatnsdcelivkamqgllkdgnpips
    aiaansgiy
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2c4zC (C:)
    asnftqfvlvdnggtgdvtvapsnfangvaewissnsrsqaykvtcsvrqssaqnrkyti
    kvevpkvatqtvggvelpvaawrsylnmeltipifatnsdcelivkamqgllkdgnpips
    aiaansgiy
    

  • Chain 'R':
    No sequence available.

  • Chain 'S':
    No sequence available.