PDB entry 2c4y

View 2c4y on RCSB PDB site
Description: ms2-RNA hairpin (2thiouracil-5) complex
Class: virus/RNA
Keywords: VIRUS/RNA, CAPSID, COMPLEX (CAPSID PROTEIN-RNA HAIRPIN), HAIRPIN, LEVIVIRUS, VIRUS/VIRAL PROTEIN/RNA, VIRUS COAT PROTEIN, RNA- BINDING, ICOSAHEDRAL VIRUS, VIRUS-RNA complex
Deposited on 2005-10-25, released 2006-01-05
The last revision prior to the SCOPe 2.08 freeze date was dated 2019-10-09, with a file datestamp of 2019-10-04.
Experiment type: XRAY
Resolution: 2.68 Å
R-factor: N/A
AEROSPACI score: 0.18 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: coat protein
    Species: Enterobacterio phage MS2 [TaxId:12022]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d2c4ya_
  • Chain 'B':
    Compound: coat protein
    Species: Enterobacterio phage MS2 [TaxId:12022]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d2c4yb_
  • Chain 'C':
    Compound: coat protein
    Species: Enterobacterio phage MS2 [TaxId:12022]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d2c4yc_
  • Chain 'R':
    Compound: 5'-r(*ap*cp*ap*up*gp*ap*gp*gp*ap*up *sur*ap*cp*cp*cp*ap*up*gp*u)-3'
    Species: ENTEROBACTERIO PHAGE MS2, synthetic [TaxId:12022]
  • Chain 'S':
    Compound: 5'-r(*ap*cp*ap*up*gp*ap*gp*gp*ap*up *sur*ap*cp*cp*cp*ap*up*gp*u)-3'
    Species: ENTEROBACTERIO PHAGE MS2, synthetic [TaxId:12022]
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2c4yA (A:)
    asnftqfvlvdnggtgdvtvapsnfangvaewissnsrsqaykvtcsvrqssaqnrkyti
    kvevpkvatqtvggvelpvaawrsylnmeltipifatnsdcelivkamqgllkdgnpips
    aiaansgiy
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2c4yB (B:)
    asnftqfvlvdnggtgdvtvapsnfangvaewissnsrsqaykvtcsvrqssaqnrkyti
    kvevpkvatqtvggvelpvaawrsylnmeltipifatnsdcelivkamqgllkdgnpips
    aiaansgiy
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2c4yC (C:)
    asnftqfvlvdnggtgdvtvapsnfangvaewissnsrsqaykvtcsvrqssaqnrkyti
    kvevpkvatqtvggvelpvaawrsylnmeltipifatnsdcelivkamqgllkdgnpips
    aiaansgiy
    

  • Chain 'R':
    No sequence available.

  • Chain 'S':
    No sequence available.