PDB entry 2c4q

View 2c4q on RCSB PDB site
Description: ms2-RNA hairpin (2one -5) complex virus
Class: virus/RNA
Keywords: virus/RNA, capsid, complex (capsid protein-RNA hairpin), hairpin, levivirus, virus/viral protein/RNA, virus coat protein, icosahedral virus
Deposited on 2005-10-21, released 2005-11-07
The last revision prior to the SCOPe 2.01 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.38 Å
R-factor: 0.19
AEROSPACI score: 0.36 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: coat protein
    Species: Enterobacterio phage MS2 [TaxId:12022]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d2c4qa_
  • Chain 'B':
    Compound: coat protein
    Species: Enterobacterio phage MS2 [TaxId:12022]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d2c4qb_
  • Chain 'C':
    Compound: coat protein
    Species: Enterobacterio phage MS2 [TaxId:12022]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d2c4qc_
  • Chain 'R':
    Compound: 5'-r(*ap*cp*ap*up*gp*ap*gp*gp*ap*up *pyo*ap*cp*cp*cp*ap*up*gp*u)-3'
    Species: ENTEROBACTERIO PHAGE MS2, synthetic [TaxId:12022]
  • Chain 'S':
    Compound: 5'-r(*ap*cp*ap*up*gp*ap*gp*gp*ap*up *pyo*ap*cp*cp*cp*ap*up*gp*u)-3'
    Species: ENTEROBACTERIO PHAGE MS2, synthetic [TaxId:12022]
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >2c4qA (A:)
asnftqfvlvdnggtgdvtvapsnfangvaewissnsrsqaykvtcsvrqssaqnrkyti
kvevpkvatqtvggvelpvaawrsylnmeltipifatnsdcelivkamqgllkdgnpips
aiaansgiy

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >2c4qB (B:)
asnftqfvlvdnggtgdvtvapsnfangvaewissnsrsqaykvtcsvrqssaqnrkyti
kvevpkvatqtvggvelpvaawrsylnmeltipifatnsdcelivkamqgllkdgnpips
aiaansgiy

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >2c4qC (C:)
asnftqfvlvdnggtgdvtvapsnfangvaewissnsrsqaykvtcsvrqssaqnrkyti
kvevpkvatqtvggvelpvaawrsylnmeltipifatnsdcelivkamqgllkdgnpips
aiaansgiy

  • Chain 'R':
    No sequence available.

  • Chain 'S':
    No sequence available.