PDB entry 2c4p

View 2c4p on RCSB PDB site
Description: crystal structure of human ubiquitin-conjugating enzyme ubch5a
Class: ligase
Keywords: thioesterification, ubiquitin-conjugating enzyme, ligase, ubl conjugation pathway
Deposited on 2005-10-21, released 2006-11-22
The last revision prior to the SCOPe 2.03 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.35 Å
R-factor: 0.232
AEROSPACI score: 0.28 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: ubiquitin-conjugating enzyme e2 d1
    Species: Homo sapiens [TaxId:9606]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • PDB 2C4P (Start-17)
    • Uniprot P51668 (18-164)
    Domains in SCOPe 2.03: d2c4pa_
  • Chain 'B':
    Compound: ubiquitin-conjugating enzyme e2 d1
    Species: Homo sapiens [TaxId:9606]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • PDB 2C4P (Start-17)
    • Uniprot P51668 (18-164)
    Domains in SCOPe 2.03: d2c4pb_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2c4pA (A:)
    mkhhhhhhpmsglvprgsmalkriqkelsdlqrdppahcsagpvgddlfhwqatimgppd
    sayqggvffltvhfptdypfkppkiafttkiyhpninsngsicldilrsqwspaltvskv
    llsicsllcdpnpddplvpdiaqiyksdkekynrharewtqkyam
    

    Sequence, based on observed residues (ATOM records): (download)
    >2c4pA (A:)
    rgsmalkriqkelsdlqrdppahcsagpvgddlfhwqatimgppdsayqggvffltvhfp
    tdypfkppkiafttkiyhpninsngsicldilrsqwspaltvskvllsicsllcdpnpdd
    plvpdiaqiyksdkekynrharewtqkyam
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2c4pB (B:)
    mkhhhhhhpmsglvprgsmalkriqkelsdlqrdppahcsagpvgddlfhwqatimgppd
    sayqggvffltvhfptdypfkppkiafttkiyhpninsngsicldilrsqwspaltvskv
    llsicsllcdpnpddplvpdiaqiyksdkekynrharewtqkyam
    

    Sequence, based on observed residues (ATOM records): (download)
    >2c4pB (B:)
    gsmalkriqkelsdlqrdppahcsagpvgddlfhwqatimgppdsayqggvffltvhfpt
    dypfkppkiafttkiyhpninsngsicldilrsqwspaltvskvllsicsllcdpnpddp
    lvpdiaqiyksdkekynrharewtqkyam